TkA02G205460 | RubberDandelionOmics

Gene overview

TkA02G205460

Reference: TK1151 Chr: Chr02 Coordinates: 52473945-52475865 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1755 bp · TkA02G205460|TK1151|cDNA

GAATCATTTCCCTAATTAAAAGGGCTTACGATATTCTTGACTTCTATTTGTTAATTTATGTAAGTGGTATATCTAAATAAAAACGTATATGAAGAAACAAGATACTGCATGTCATTTGAAAGGTGGTAAAATTTTATTTTTCGCCACTTAGACTCAAAAAGCCATCAGTTTTTTTCTCAAAGTTTTAGCCATTGTTTACCTTATTTTTTTCATTACATCCCAAAACTAACCAAAGGATACGATTTTGAGCATAAATTTCA...

CDS

Download CDS FASTA

1224 bp · TkA02G205460|TK1151|CDS

ATGGAGAAAATATGGCAATGCTCAAACCTCCTCCATTCAACATCTAAACACCTCCATCCCCCACCACCGCCACCACCACCACCACCAACCACCGCCACTTCCCCTCCACTTATCAAACTCTCACGTAGACATCTCGCAATCAGCACCAATTCCTCTCTCCTCCTCATCCTTTCTTCTCAATTTCAAGACCAAATCCATCTCCCCAAGGCAAAAGCACAGGAACAAAACCTCTTCACGCCGGAAAATCCTCAAATCGTAGA...

Protein

Download Protein FASTA

407 aa · TkA02G205460|TK1151|PROTEIN

MEKIWQCSNLLHSTSKHLHPPPPPPPPPPTTATSPPLIKLSRRHLAISTNSSLLLILSSQFQDQIHLPKAKAQEQNLFTPENPQIVDDIPIDTSNITTTPADDNPVDITTTTTPTEDNPVETSTTTTDNSDTTGENPVETSSTTSPTEENQAETSSTVSPTDENLVETSSTTAIDSCTDKVLTKRAFLDVSIDGKPIGRVVIGLYGNNVPAGATRFSDFVSGAAGVSYRRKEFIKITPSYIQHGGVRSYGVDAELAAKTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G205460`
TK1151 ID	TkA02G205460
OH-1004 ID	LXL04_028151
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	27.300
Protein coverage (%)	TK1151 55.528 / OH-1004 75.503 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G205460

Location Chr02:52473945-52475865 (+)

Description Similar to CYP28: Peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74070`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028151 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000413 protein peptidyl-prolyl isomerization Biological Process

GO:0006457 protein folding Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0031978 plastid thylakoid lumen Cellular Component

KEGG gene cross-reference

afm:AFUA_4G07650

ath:AT5G35100

lgi:LOTGIDRAFT_222979

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · TkA02G205460 · TK1151

Mitochondrion0.023

Rank 2 · TkA02G205460 · TK1151

Nucleus0.019

Rank 3 · TkA02G205460 · TK1151

Cytoplasm0.016

Rank 4 · TkA02G205460 · TK1151

Cell membrane0.015

Rank 5 · TkA02G205460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22812CR_prot_dom_plant20-29 aa

PF00160Pro_isomerase188-368 aa

PF22812CR_prot_dom_plant296-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G205460	`PF22812`	CR_prot_dom_plant	20	29	0.055	14.6
TkA02G205460	`PF00160`	Pro_isomerase	188	368	2.7e-15	57.7
TkA02G205460	`PF22812`	CR_prot_dom_plant	296	330	0.055	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HTT6`	Arabidopsis thaliana	sp\|F4HTT6\|CP26B_ARATH Peptidyl-prolyl cis-trans isomerase CYP26-2, chloroplastic	66.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card