TkA02G195770 | RubberDandelionOmics

Gene overview

TkA02G195770

Reference: TK1151 Chr: Chr02 Coordinates: 50109453-50114770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · TkA02G195770|TK1151|cDNA

ATGTCTCATTTATTCTATGCAGACGGTGCAATCTTTATGGGGAAGTGGGATCGGGAGAATATTATGAATTTGGTACGAATTTTAAAAGTATTTTATATATCTTCTGGTCTCCAAATTAATCTTCATAAATCAAAGGTGTATGGAGTTGGGGTTAGTGATCAGTCGATCTTAGATATGGCGGTTCATACCGGTCGTGCTGCTGATCAGTTCCCGATTATATATCTAGGCTTACCGATGAGAGATAATATGTCTCGAATTCA...

CDS

Download CDS FASTA

1389 bp · TkA02G195770|TK1151|CDS

ATGTCTCATTTATTCTATGCAGACGGTGCAATCTTTATGGGGAAGTGGGATCGGGAGAATATTATGAATTTGGTACGAATTTTAAAAGTATTTTATATATCTTCTGGTCTCCAAATTAATCTTCATAAATCAAAGGTGTATGGAGTTGGGGTTAGTGATCAGTCGATCTTAGATATGGCGGTTCATACCGGTCGTGCTGCTGATCAGTTCCCGATTATATATCTAGGCTTACCGATGAGAGATAATATGTCTCGAATTCA...

Protein

Download Protein FASTA

462 aa · TkA02G195770|TK1151|PROTEIN

MSHLFYADGAIFMGKWDRENIMNLVRILKVFYISSGLQINLHKSKVYGVGVSDQSILDMAVHTGRAADQFPIIYLGLPMRDNMSRIQSWDSLIEKFRNRLSKWKMKMLSIGGSLILVKSVLGSFGIYYLSLLFMPVAVEKKLEACRARFLWGIEDHERKLQWVRWVLVLNDRASGGLAVGSLKAFNQTLLYKWRWRFLTQPNIIWVRFIKSCYGATADQDVVVSYYWTGSGWSCVWSREIDGGRTGDQLMGLMRVLSHVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G195770`
TK1151 ID	TkA02G195770
OH-1004 ID	LXL04_015205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.400
Protein coverage (%)	TK1151 100.000 / OH-1004 48.938 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G195770`
Location	Chr02:50109453-50114770 (+)
Description	Similar to At1g61190: Probable disease resistance protein At1g61190
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015205` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0016045 detection of bacterium Biological Process GO:0042742 defense response to bacterium Biological Process GO:0098542 defense response to other organism Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function
KEGG gene cross-reference	ath:AT1G61180 ath:AT1G61190 ath:AT1G61300 ath:AT4G26090 ath:AT4G27220 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · TkA02G195770 · TK1151

Nucleus0.256

Rank 2 · TkA02G195770 · TK1151

Cell membrane0.100

Rank 3 · TkA02G195770 · TK1151

Golgi apparatus0.078

Rank 4 · TkA02G195770 · TK1151

Lysosome / Vacuole0.073

Rank 5 · TkA02G195770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_13-75 aa

PF13966zf-RVT278-363 aa

PF00078RVT_1282-304 aa

PF25536DUF7920288-352 aa

PF12356BIRC6358-415 aa

PF25536DUF7920376-405 aa

PF13966zf-RVT404-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G195770	`PF00078`	RVT_1	3	75	0.09	13.4
TkA02G195770	`PF13966`	zf-RVT	278	363	1e-18	68.4
TkA02G195770	`PF00078`	RVT_1	282	304	0.09	13.4
TkA02G195770	`PF25536`	DUF7920	288	352	0.15	11.8
TkA02G195770	`PF12356`	BIRC6	358	415	0.31	11.5
TkA02G195770	`PF25536`	DUF7920	376	405	0.15	11.8
TkA02G195770	`PF13966`	zf-RVT	404	415	1e-18	68.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card