TkA02G193970 | RubberDandelionOmics

Gene overview

TkA02G193970

Reference: TK1151 Chr: Chr02 Coordinates: 49709215-49716191 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · TkA02G193970|TK1151|cDNA

ATGATGATGAGGGGTGTAATGGATCTGCTGGTGGCGAAAGATGTGCAAATGAGAATGATGAAAGGAGATGCGGCTCGTTGGTCGTTTGGAGCTCCATTGCTGAAGGGCGTTGTTATTGGATTTGATGAACGACTTACGGATTTGAAGGCGATGGTGGATTCTTTGAGGTGTGCATCAATGGCGACTGAAGAACTGATTGAAGTCAAATTTAGGTTAGCTGATGGCAGTGATATCAGACCAAGCAAATACAACTCTGTTAC...

CDS

Download CDS FASTA

1533 bp · TkA02G193970|TK1151|CDS

ATGATGATGAGGGGTGTAATGGATCTGCTGGTGGCGAAAGATGTGCAAATGAGAATGATGAAAGGAGATGCGGCTCGTTGGTCGTTTGGAGCTCCATTGCTGAAGGGCGTTGTTATTGGATTTGATGAACGACTTACGGATTTGAAGGCGATGGTGGATTCTTTGAGGTGTGCATCAATGGCGACTGAAGAACTGATTGAAGTCAAATTTAGGTTAGCTGATGGCAGTGATATCAGACCAAGCAAATACAACTCTGTTAC...

Protein

Download Protein FASTA

510 aa · TkA02G193970|TK1151|PROTEIN

MMMRGVMDLLVAKDVQMRMMKGDAARWSFGAPLLKGVVIGFDERLTDLKAMVDSLRCASMATEELIEVKFRLADGSDIRPSKYNSVTTVRSLKEKIISQWPKEAFATSHSYFSDKPHFSTINCAEMARIACHHMGALPLKSSLLTRSSSICFSDTSLSLGFRRRFSSNSKISMSLKAGIVGLPNVGKSTLFNAVVENGKAQAANFPFCTIEPNVGIVAVPDSRLQVLSNLSKSQRSVPASIEFVDIAGLVKGASQGEVVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G193970`
TK1151 ID	TkA02G193970
OH-1004 ID	LXL04_016087
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.400
Protein coverage (%)	TK1151 74.118 / OH-1004 94.964 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G193970`
Location	Chr02:49709215-49716191 (+)
Description	Similar to ychF: Ribosome-binding ATPase YchF (Bacillus subtilis (strain 168)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016087` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006979 response to oxidative stress Biological Process GO:0005737 cytoplasm Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0005525 GTP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0043022 ribosome binding Molecular Function GO:0043023 ribosomal large subunit binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	bsu:BSU40920 ecj:JW1194 eco:b1203 ecoc:C3026_07075 hin:HI_0393 pmu:PM0163 sfl:SF1206 sfx:S1290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.929

Rank 1 · TkA02G193970 · TK1151

Mitochondrion0.097

Rank 2 · TkA02G193970 · TK1151

Cytoplasm0.053

Rank 3 · TkA02G193970 · TK1151

Nucleus0.035

Rank 4 · TkA02G193970 · TK1151

Peroxisome0.024

Rank 5 · TkA02G193970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13881Rad60-SLD_265-105 aa

PF01926MMR_HSR1177-264 aa

PF02421FeoB_N178-226 aa

PF09429Wbp11286-328 aa

PF02421FeoB_N379-408 aa

PF06071YchF-GTPase_C440-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G193970	`PF13881`	Rad60-SLD_2	65	105	2.5e-12	47.6
TkA02G193970	`PF01926`	MMR_HSR1	177	264	8.3e-16	58.8
TkA02G193970	`PF02421`	FeoB_N	178	226	1.2e-06	28.8
TkA02G193970	`PF09429`	Wbp11	286	328	0.26	12.4
TkA02G193970	`PF02421`	FeoB_N	379	408	1.2e-06	28.8
TkA02G193970	`PF06071`	YchF-GTPase_C	440	503	2.4e-25	89.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card