TkA02G191800 | RubberDandelionOmics

Gene overview

TkA02G191800

Reference: TK1151 Chr: Chr02 Coordinates: 49169168-49173161 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1150 bp · TkA02G191800|TK1151|cDNA

ATTACACATAAAATCGAATCTTGGTTAACCTCCGATTAAAAATGTCGGCCCCTCATCTCTCATACGGCCCAAAAACTGCCGTCTTTACCAATGGTCACGGTTCGCCCACCACCTCATACCCTTCTCCAGAGGCATCTTACGAAGAAATCACTCAAAACCCTCAATTTTCTTGGATAAGCTTCAAATATTTCACTCGGTTTTTGGAACCAAGTTCAAGATTCCTATCATTGGAGGGAAGTCTTTAGATCTTCACCGACTTT...

CDS

Download CDS FASTA

576 bp · TkA02G191800|TK1151|CDS

ATGGAAGGAAGTGATGGCTGTGTTCAAATTGGTCCTACAATCACAAACGCGTCTTTTGTCTTAAGAAAATACTATCTTTCATTGCTTTATCATTTCGAGCAGGTTTATTACTTCCGCAAGAAAACTCCCACCATTATTCCACCTGATATTACAAACAGACTTACAGACGGCTCAGTCTCTGGTTCTTTAAAGAATCTATTTTCTGGAAGGACAAGTGTGGAGGTGGGGGGACAAGTGACTGGGACAATTGATAACAGATT...

Protein

Download Protein FASTA

191 aa · TkA02G191800|TK1151|PROTEIN

MEGSDGCVQIGPTITNASFVLRKYYLSLLYHFEQVYYFRKKTPTIIPPDITNRLTDGSVSGSLKNLFSGRTSVEVGGQVTGTIDNRFENGYLVSVEMGTEKLSGFLYHVPLQNPSMASRNMYELAIREASPELEADTTGYDVFFTEHYIRLKPLYHGQENVIRKRIQVLWNTLTEDEKQVYQETGSRGKER

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G191800`
TK1151 ID	TkA02G191800
OH-1004 ID	LXL04_016108
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 95.812 / OH-1004 64.894 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G191800

Location Chr02:49169168-49173161 (+)

Description Similar to HMGB10: High mobility group B protein 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13350`	Binds preferentially DNA with A/T-rich content.	No verified direct reference in this release
`At1g76110`	Binds preferentially DNA with A/T-rich content.	NUCLEAR FUSION DEFECTIVE1 encodes the Arabidopsis RPL21M protein and is required for karyogamy during female gametophyte development and fertilization.2006 · DOI: 10.1104/pp.106.079319 A novel family of plant DNA-binding proteins containing both HMG-box and AT-rich interaction domains.2008 · DOI: 10.1021/bi801772k
`At1g04880`	Binds preferentially DNA with A/T-rich content.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016108 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0006337 nucleosome disassembly Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

KEGG gene cross-reference

ath:AT1G04880

ath:AT1G55650

ath:AT1G76110

ath:AT3G13350

mmu:77044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.804

Rank 1 · TkA02G191800 · TK1151

Cytoplasm0.224

Rank 2 · TkA02G191800 · TK1151

Cell membrane0.048

Rank 3 · TkA02G191800 · TK1151

Endoplasmic reticulum0.030

Rank 4 · TkA02G191800 · TK1151

Mitochondrion0.024

Rank 5 · TkA02G191800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00505HMG_box29-54 aa

PF27637MNM1_beta79-108 aa

PF00505HMG_box162-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G191800	`PF00505`	HMG_box	29	54	0.0051	18.0
TkA02G191800	`PF27637`	MNM1_beta	79	108	7.3e-07	29.4
TkA02G191800	`PF00505`	HMG_box	162	190	0.0051	18.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTT3`	Arabidopsis thaliana	sp\|Q9LTT3\|HMG10_ARATH High mobility group B protein 10	40.100%	Swiss-Prot	Medium
`Q9SGS2`	Arabidopsis thaliana	sp\|Q9SGS2\|HMGB9_ARATH High mobility group B protein 9	31.100%	Swiss-Prot	Medium
`Q9MAT6`	Arabidopsis thaliana	sp\|Q9MAT6\|HMG15_ARATH High mobility group B protein 15	40.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card