TkA02G184320 | RubberDandelionOmics

Gene overview

TkA02G184320

Reference: TK1151 Chr: Chr02 Coordinates: 47372998-47375832 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2762 bp · TkA02G184320|TK1151|cDNA

GTTTTAAAGCCGCTGCGTAGGACACGAGCATTTTCCAGACTAGATAAGTGTCGTCCCTGGAGTGGCCTATTTTAAAATTTCAATAAACATTTAGGGTTTTACTGTCAAAATTGCCAACCGATCCATATCTCTCACGCAAGCATTTGGTAAGGTTCTTCCAGTTTCTGGTAAGGTCTCACAATCTCATCCTCAAATTCTCCTCTTTCATTTTCTTTTAATGATAGCTTCGATTTAGAAACCAGTTCGTTAGATTGTAGAAG...

CDS

Download CDS FASTA

1932 bp · TkA02G184320|TK1151|CDS

ATGGATCAAAACGAGGCCCACGGCGGTGGAGATGCGAACGAGCAGTTCCATCGGAACGAAGCAATCTCCGCCGTCGTTGACGAGGGTTTCTTGGGGGAAGACGATGATGATTATGAGGATCTTTATAACGACGTTAATGTTGGCGAGGGTTTTCTTCAAACTCTTCAGAAGAATAACGATGTAGGGTTTAGGAACGAGGAAGAAGTTAAGAAGGAGAAATCGCAACCGGTCCCTCAGCCGGTTCATCACCCACAACCCTT...

Protein

Download Protein FASTA

643 aa · TkA02G184320|TK1151|PROTEIN

MDQNEAHGGGDANEQFHRNEAISAVVDEGFLGEDDDDYEDLYNDVNVGEGFLQTLQKNNDVGFRNEEEVKKEKSQPVPQPVHHPQPLDDVAGGGGRGEMKFENNDGVSTRADANSNIGLGVKEVSGRGSGGGLRVELGQSSAKVGEVESRTMDANNNNMPNLVAGQHPPHVGTVGSLSNPADDGIPRQSSGNVNGSGGNAFGNGGVGGGMNSNAVGGGGGGGGGGTILFVGDLHWWTTDAELETELCKYGHVKEVKFFDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G184320`
TK1151 ID	TkA02G184320
OH-1004 ID	LXL04_016152
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 93.002 / OH-1004 87.848 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G184320`
Location	Chr02:47372998-47375832 (-)
Description	Similar to Glycine-rich RNA-binding protein GRP1A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016152` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0006509 membrane protein ectodomain proteolysis Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0010468 regulation of gene expression Biological Process GO:0034087 establishment of mitotic sister chromatid cohesion Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:0048026 positive regulation of mRNA splicing, via spliceosome Biological Process GO:0048589 developmental growth Biological Process
KEGG gene cross-reference	dre:794108 hsa:27288 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · TkA02G184320 · TK1151

Cytoplasm0.081

Rank 2 · TkA02G184320 · TK1151

Cell membrane0.018

Rank 3 · TkA02G184320 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA02G184320 · TK1151

Plastid0.007

Rank 5 · TkA02G184320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13893RRM_5224-296 aa

PF00076RRM_1228-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G184320	`PF13893`	RRM_5	224	296	0.13	12.7
TkA02G184320	`PF00076`	RRM_1	228	297	1.3e-14	54.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card