TkA02G174780 | RubberDandelionOmics

Gene overview

TkA02G174780

Reference: TK1151 Chr: Chr02 Coordinates: 45015341-45020156 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2636 bp · TkA02G174780|TK1151|cDNA

TGTACGCCAAAATTAACTTTTATTTAATTTAATGCGTTTTTTCAGCATGGAAACAACGTCGATTTGTATCTCCTTCGCCATCAACTACTGTCTATTCTTTCCCTTGCTTCCTCCTCTCACTAACTCGAAACGTCGATTCCGAGGTACCATTACCGAGAAGCAAGAAGCTGCCGAAGTTCAGTTAATCTCCGGTGTAGATATGCCGGCAATGTGGAAACTCCGGTGGCTACTAAATTTATTGCTATTTGTCTGTTCAGTAT...

CDS

Download CDS FASTA

2550 bp · TkA02G174780|TK1151|CDS

ATGCGTTTTTTCAGCATGGAAACAACGTCGATTTGTATCTCCTTCGCCATCAACTACTGTCTATTCTTTCCCTTGCTTCCTCCTCTCACTAACTCGAAACGTCGATTCCGAGGTACCATTACCGAGAAGCAAGAAGCTGCCGAAGTTCAGTTAATCTCCGGTGTAGATATGCCGGCAATGTGGAAACTCCGGTGGCTACTAAATTTATTGCTATTTGTCTGTTCAGTATCATTGACGGATTCCCGGGGATCTAGTAACAG...

Protein

Download Protein FASTA

849 aa · TkA02G174780|TK1151|PROTEIN

MRFFSMETTSICISFAINYCLFFPLLPPLTNSKRRFRGTITEKQEAAEVQLISGVDMPAMWKLRWLLNLLLFVCSVSLTDSRGSSNRASKWNTLNGDRPLVIAHGGFSGLFPDSSEIAYNLAKVISVPDVILWCDVQLTSDAAGICFPDLTLDNSSTITQVFDKRVPATYPVNGILTQGWFPVDFSLKDLQNVSLIQNVFSRTPYYDGVYPILTVEQVTAKGSLWLNIQHDAFFTQHNLSMKNFVIDASKHNLVKYISSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G174780`
TK1151 ID	TkA02G174780
OH-1004 ID	LXL04_016201
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.800
Protein coverage (%)	TK1151 93.640 / OH-1004 57.178 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G174780

Location Chr02:45015341-45020156 (+)

Description Similar to GDPDL3: Glycerophosphodiester phosphodiesterase GDPDL3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26690`	Involved in primary cell wall organization.	The glycerophosphoryl diester phosphodiesterase-like proteins SHV3 and its homologs play important roles in cell wall organization.2008 · DOI: 10.1093/pcp/pcn120
`At1g66970`	Hydrolyzes glycerolphosphoglycerol, glycerophosphocholine and glycerophosphoethanolamine in vitro.	Characterization of the Arabidopsis glycerophosphodiester phosphodiesterase (GDPD) family reveals a role of the plastid-localized AtGDPD1 in maintaining cellular phosphate homeostasis under phosphate starvation.2011 · DOI: 10.1111/j.1365-313x.2011.04538.x
`At5g55480`	Involved in primary cell wall organization.	The glycerophosphoryl diester phosphodiesterase-like proteins SHV3 and its homologs play important roles in cell wall organization.2008 · DOI: 10.1093/pcp/pcn120
`At1g66980`	Atypical receptor-like kinase involved in disease resistance.	Activation of plant immune responses by a gain-of-function mutation in an atypical receptor-like kinase.2010 · DOI: 10.1104/pp.110.158501
`At3g20520`	Glycerophosphodiester phosphodiesterase GDPDL5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016201 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT4G26690

ath:AT5G55480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.484

Rank 1 · TkA02G174780 · TK1151

Extracellular0.247

Rank 2 · TkA02G174780 · TK1151

Cytoplasm0.120

Rank 3 · TkA02G174780 · TK1151

Endoplasmic reticulum0.101

Rank 4 · TkA02G174780 · TK1151

Lysosome / Vacuole0.084

Rank 5 · TkA02G174780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03009GDPD134-390 aa

PF15296Codanin-1_C231-262 aa

PF03009GDPD419-709 aa

PF15296Codanin-1_C556-599 aa

PF24584Ig_CYK3_C564-613 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G174780	`PF03009`	GDPD	134	390	2.1e-32	113.9
TkA02G174780	`PF15296`	Codanin-1_C	231	262	0.066	14.0
TkA02G174780	`PF03009`	GDPD	419	709	2.1e-32	113.9
TkA02G174780	`PF15296`	Codanin-1_C	556	599	0.066	14.0
TkA02G174780	`PF24584`	Ig_CYK3_C	564	613	0.06	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ11`	Arabidopsis thaliana	sp\|Q9SZ11\|GPDL3_ARATH Glycerophosphodiester phosphodiesterase GDPDL3	54.100%	Swiss-Prot	High
`Q7Y208`	Arabidopsis thaliana	sp\|Q7Y208\|GPDL1_ARATH Glycerophosphodiester phosphodiesterase GDPDL1	51.900%	Swiss-Prot	High
`Q9FJ62`	Arabidopsis thaliana	sp\|Q9FJ62\|GPDL4_ARATH Glycerophosphodiester phosphodiesterase GDPDL4	48.800%	Swiss-Prot	Medium
`D7SFH9`	Arabidopsis thaliana	sp\|D7SFH9\|LRL26_ARATH Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4	48.500%	Swiss-Prot	Medium
`F4JEQ1`	Arabidopsis thaliana	sp\|F4JEQ1\|GPDL5_ARATH Glycerophosphodiester phosphodiesterase GDPDL5	48.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card