Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1164 bp · TkA02G174060|TK1151|cDNA
ATGTACACAAAATATGCAGATAAGGCCGGTTTTGATGTCCGATTGAACACAACCACGCGTTTCGCAGACGATAATTCTATACGAATCAGATACGTAGTATGCAGCAAAACCGGGAAGATACCTAATCGATCAATGAATAGTTTGGACACATCCTGTAGTAAAAAGCAAAGAAACTCGAGCTTTAAAGTGACCAACTGTAAAGCATTGATTAAATTCGAAAGGATTGATCGTGAATTGAGTTGTATGTTTTGGGCAGATGA...
1164 bp · TkA02G174060|TK1151|CDS
ATGTACACAAAATATGCAGATAAGGCCGGTTTTGATGTCCGATTGAACACAACCACGCGTTTCGCAGACGATAATTCTATACGAATCAGATACGTAGTATGCAGCAAAACCGGGAAGATACCTAATCGATCAATGAATAGTTTGGACACATCCTGTAGTAAAAAGCAAAGAAACTCGAGCTTTAAAGTGACCAACTGTAAAGCATTGATTAAATTCGAAAGGATTGATCGTGAATTGAGTTGTATGTTTTGGGCAGATGA...
Protein
Download Protein FASTA387 aa · TkA02G174060|TK1151|PROTEIN
MYTKYADKAGFDVRLNTTTRFADDNSIRIRYVVCSKTGKIPNRSMNSLDTSCSKKQRNSSFKVTNCKALIKFERIDRELSCMFWADETNKAYYKEFGDVISFDATFRSNKYGMRFVPFTAIDHHKKIVTIGAGLICNESIEMYTWLLESFLKAHGKQPGIVLIDQHAAVFQAVKDVFPESRLRWCMWHIMEKLPKKVDPKILQTTDFRKRFKDIVWEERSNPEECEEEWMSLINEYNLGKKRWFRDMYRRRRYWLPAYFK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G174060 |
|---|---|
| TK1151 ID | TkA02G174060 |
| OH-1004 ID | LXL04_008866 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 81.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 37.638Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G174060 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:44736171-44737901 (-) | |||||||||
| Description | Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009639 response to red or far red light Biological Process GO:0010017 red or far-red light signaling pathway Biological Process GO:0010018 far-red light signaling pathway Biological Process GO:0010218 response to far red light Biological Process GO:0042753 positive regulation of circadian rhythm Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:1900056 negative regulation of leaf senescence Biological Process GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0008270 zinc ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G52520 ath:AT1G76320 ath:AT2G27110 ath:AT4G15090 ath:AT4G38180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03101FAR12-74 aaPF10436BCDHK_Adom362-172 aaPF21056ZSWIM1-3_RNaseH-like76-181 aaPF10551MULE99-192 aaPF00872Transposase_mut122-278 aaPF21056ZSWIM1-3_RNaseH-like282-287 aaPF03101FAR1294-317 aaPF10551MULE314-347 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G174060 | PF03101 | FAR1 | 2 | 74 | 2.7e-08 | 35.1 |
| TkA02G174060 | PF10436 | BCDHK_Adom3 | 62 | 172 | 0.12 | 13.0 |
| TkA02G174060 | PF21056 | ZSWIM1-3_RNaseH-like | 76 | 181 | 5.9e-09 | 36.6 |
| TkA02G174060 | PF10551 | MULE | 99 | 192 | 6.2e-28 | 97.8 |
| TkA02G174060 | PF00872 | Transposase_mut | 122 | 278 | 8.1e-05 | 22.4 |
| TkA02G174060 | PF21056 | ZSWIM1-3_RNaseH-like | 282 | 287 | 5.9e-09 | 36.6 |
| TkA02G174060 | PF03101 | FAR1 | 294 | 317 | 2.7e-08 | 35.1 |
| TkA02G174060 | PF10551 | MULE | 314 | 347 | 6.2e-28 | 97.8 |
| TkA02G174060 | PF10436 | BCDHK_Adom3 | 318 | 338 | 0.12 | 13.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.