RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G172540
Reference: TK1151 Chr: Chr02 Coordinates: 44336586-44336950 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

321 bp · TkA02G172540|TK1151|cDNA

GGACTATTCGGTTCTCATATAATAAACCAAAACCAATCTAAAATCCAAAATAATAATTCGGTTTTCGTCAAAACCAATCCGAAAATCCAAATATCCGAACTATATAGTCCAATCCAAATTATCCAATTGGATAATTTGGTTTATCCAAATAGTGAACATCCCTATTTATGTGCAACCATTTTTATTACTCGGATTGGGCTTGATGATGTATGTCTTTCAGAAAACCTAACCCTTACCTCAAACTTGGTGGCTGATATTTT...

CDS

Download CDS FASTA

321 bp · TkA02G172540|TK1151|CDS

GGACTATTCGGTTCTCATATAATAAACCAAAACCAATCTAAAATCCAAAATAATAATTCGGTTTTCGTCAAAACCAATCCGAAAATCCAAATATCCGAACTATATAGTCCAATCCAAATTATCCAATTGGATAATTTGGTTTATCCAAATAGTGAACATCCCTATTTATGTGCAACCATTTTTATTACTCGGATTGGGCTTGATGATGTATGTCTTTCAGAAAACCTAACCCTTACCTCAAACTTGGTGGCTGATATTTT...

Protein

Download Protein FASTA

106 aa · TkA02G172540|TK1151|PROTEIN

GLFGSHIINQNQSKIQNNNSVFVKTNPKIQISELYSPIQIIQLDNLVYPNSEHPYLCATIFITRIGLDDVCLSENLTLTSNLVADILIVSKLKMKIVVFIYIKYWL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G172540
TK1151 IDTkA02G172540
OH-1004 IDLXL04_031551
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)81.000
Protein coverage (%)TK1151 39.623 / OH-1004 6.452
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G172540
LocationChr02:44336586-44336950 (+)
DescriptionSimilar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006633 fatty acid biosynthetic process Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009403 toxin biosynthetic process Biological Process
GO:0009585 red, far-red light phototransduction Biological Process
GO:0010017 red or far-red light signaling pathway Biological Process
GO:0010218 response to far red light Biological Process
GO:0032259 methylation Biological Process
GO:0042753 positive regulation of circadian rhythm Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:1900056 negative regulation of leaf senescence Biological Process
KEGG gene cross-reference
ath:AT1G10240
ath:AT1G76320
ath:AT3G22170
ath:AT4G38180
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385
Rank 1 · TkA02G172540 · TK1151
Nucleus0.302
Rank 2 · TkA02G172540 · TK1151
Mitochondrion0.217
Rank 3 · TkA02G172540 · TK1151
Cell membrane0.076
Rank 4 · TkA02G172540 · TK1151
Endoplasmic reticulum0.067
Rank 5 · TkA02G172540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser