TkA02G171510 | RubberDandelionOmics

Gene overview

TkA02G171510

Reference: TK1151 Chr: Chr02 Coordinates: 44038193-44039293 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · TkA02G171510|TK1151|cDNA

ATGAGCTCAATGCGGGTGCAGATTCAGCCGTCGGGTCGGAGCGTCACACTGGCCGCTGATAACACCACCACCGTTGTCCGGCCGTATGCAATGCAAGGAAATCCCTACGTTATCAACGACATAACTCCGGTAATGATCACAAGCTCTGAGCTAGAGCGACCTACTTGTGATCATAACCACCAACACCCCGCCGTGATCTTCTCATCCGGTGGATACACCGGAAACATATTCCACGAATTCAACGAAAACATCATACCTCT...

CDS

Download CDS FASTA

921 bp · TkA02G171510|TK1151|CDS

ATGAGCTCAATGCGGGTGCAGATTCAGCCGTCGGGTCGGAGCGTCACACTGGCCGCTGATAACACCACCACCGTTGTCCGGCCGTATGCAATGCAAGGAAATCCCTACGTTATCAACGACATAACTCCGGTAATGATCACAAGCTCTGAGCTAGAGCGACCTACTTGTGATCATAACCACCAACACCCCGCCGTGATCTTCTCATCCGGTGGATACACCGGAAACATATTCCACGAATTCAACGAAAACATCATACCTCT...

Protein

Download Protein FASTA

306 aa · TkA02G171510|TK1151|PROTEIN

MSSMRVQIQPSGRSVTLAADNTTTVVRPYAMQGNPYVINDITPVMITSSELERPTCDHNHQHPAVIFSSGGYTGNIFHEFNENIIPLFITSKLFRSRVHFIVVDHKTSFIQKYRRVFSRLSDHEIINPAVDSSVHCFPGAVTGLKFHKFLGVNTSETPQGYYSMPDFREFIRQTYRLKTRSVVMVGAHGAGLANEIFLPDGGVMVQVRPLGFQWDVDSFYSEPGPAMGLKYLEYMIEPEESSLADVYGLDHPVLRDTASV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G171510`
TK1151 ID	TkA02G171510
OH-1004 ID	LXL04_016246
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.100
Protein coverage (%)	TK1151 100.000 / OH-1004 76.891 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G171510

Location Chr02:44038193-44039293 (-)

Description Similar to XAT2: Alpha-1,3-arabinosyltransferase XAT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10320`	Glycosyletransferase required for the proper composition and structural properties of released seed coat mucilage.	Highly Branched Xylan Made by IRREGULAR XYLEM14 and MUCILAGE-RELATED21 Links Mucilage to Arabidopsis Seeds.2015 · DOI: 10.1104/pp.15.01441 Xylans Provide the Structural Driving Force for Mucilage Adhesion to the Arabidopsis Seed Coat.2016 · DOI: 10.1104/pp.16.00211

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0330200`	Glycosyltransferase involved in the arabinosylation of xylan, the major hemicellulose (non-cellulosic component) of primary and secondary walls of angiosperms.	No verified direct reference in this release
`Os03g0567600`	Glycosyltransferase involved in the arabinosylation of xylan, the major hemicellulose (non-cellulosic component) of primary and secondary walls of angiosperms.	No verified direct reference in this release
`Os06g0707000`	Glycosyltransferase involved in the xylosylation of xylan, the major hemicellulose (non-cellulosic component) of primary and secondary walls of angiosperms.	A Novel Rice Xylosyltransferase Catalyzes the Addition of 2-O-Xylosyl Side Chains onto the Xylan Backbone.2018 · DOI: 10.1093/pcp/pcy003
`Os02g0329800`	Glycosyltransferase involved in the xylosylation of xylan, the major hemicellulose (non-cellulosic component) of primary and secondary walls of angiosperms.	XAX1 from glycosyltransferase family 61 mediates xylosyltransfer to rice xylan.2012 · DOI: 10.1073/pnas.1202079109

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016246 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0035252 UDP-xylosyltransferase activity Molecular Function

GO:0047517 1,4-beta-D-xylan synthase activity Molecular Function

GO:0052636 arabinosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G10320

dosa:Os02g0329800

dosa:Os02g0330200

dosa:Os03g0567600

dosa:Os06g0707000

osa:4329203

osa:4329205

osa:4333275

osa:4342010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.351

Rank 1 · TkA02G171510 · TK1151

Golgi apparatus0.304

Rank 2 · TkA02G171510 · TK1151

Lysosome / Vacuole0.136

Rank 3 · TkA02G171510 · TK1151

Cell membrane0.091

Rank 4 · TkA02G171510 · TK1151

Cytoplasm0.089

Rank 5 · TkA02G171510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04577Glyco_transf_6198-109 aa

PF04577Glyco_transf_61176-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G171510	`PF04577`	Glyco_transf_61	98	109	0.065	14.2
TkA02G171510	`PF04577`	Glyco_transf_61	176	205	0.065	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS43`	Arabidopsis thaliana	sp\|Q9SS43\|MUC21_ARATH Xylan glycosyltransferase MUCI21	34.200%	Swiss-Prot	Low
`Q6ZFR0`	Oryza sativa subsp. japonica	sp\|Q6ZFR0\|XAT2_ORYSJ Alpha-1,3-arabinosyltransferase XAT2	31.800%	Swiss-Prot	Medium
`Q10I20`	Oryza sativa subsp. japonica	sp\|Q10I20\|XAT3_ORYSJ Alpha-1,3-arabinosyltransferase XAT3	30.900%	Swiss-Prot	Medium
`Q5Z8T8`	Oryza sativa subsp. japonica	sp\|Q5Z8T8\|XYXT1_ORYSJ Beta-1,2-xylosyltransferase XYXT1	31.500%	Swiss-Prot	Medium
`Q6Z7I3`	Oryza sativa subsp. japonica	sp\|Q6Z7I3\|XAX1_ORYSJ Beta-1,2-xylosyltransferease XAX1	41.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card