TkA02G161860 | RubberDandelionOmics

Gene overview

TkA02G161860

Reference: TK1151 Chr: Chr02 Coordinates: 41497015-41501102 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

745 bp · TkA02G161860|TK1151|cDNA

CTAAAATCACGCTCTCATCTATTCTTCATGCGACAAAATTGAGCGCGTTTTCAGCCTCTTTCGTTATCTTTATCTTCAAATTATCATCCGAAGTCTTCCCCACATGAATACGACTATCGATTGCTGTCAATGCACTGGAATTCTGATCAGAAATCCTCAATTCTCAGCAGAATATTCCAATTATCAGCATTCCCAGGTTTATAAATTTGGCGGACCGTCCACCCCTTGCTTTTGACAATGGAAGTGGAATAACGAAGGTT...

CDS

Download CDS FASTA

357 bp · TkA02G161860|TK1151|CDS

ATGTTCCCCAGTGTTGTGGGTAGGCCACGAGACAGTGGCTCTATGGTGGATGGAAAAGATGCTCATGTAGGAGATGGTGCCATGTCGAGAAGTGGTATCTTGACTTTGAAATACCCTATTGAACATGGTATTATCTGCAACTCGGACGATATGGAAAAGCTTTGGCATCACACTTATACTGAGCTTCAAGTTTCTCCTGAAGAGCGGCCCGTGCTCCTTACTGAGGCATTACTAAATCCTAAGACAAACAAAGAAAAGAC...

Protein

Download Protein FASTA

118 aa · TkA02G161860|TK1151|PROTEIN

MFPSVVGRPRDSGSMVDGKDAHVGDGAMSRSGILTLKYPIEHGIICNSDDMEKLWHHTYTELQVSPEERPVLLTEALLNPKTNKEKTIQIMFETFNIPAIYFGIQPVLSLCASGRTTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G161860`
TK1151 ID	TkA02G161860
OH-1004 ID	LXL04_016288
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.600
Protein coverage (%)	TK1151 99.153 / OH-1004 36.111 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G161860`
Location	Chr02:41497015-41501102 (-)
Description	Similar to ACT7: Actin-7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016288` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006893 Golgi to plasma membrane transport Biological Process GO:0008104 intracellular protein localization Biological Process GO:0009416 response to light stimulus Biological Process GO:0009611 response to wounding Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0009733 response to auxin Biological Process GO:0009845 seed germination Biological Process GO:0010053 root epidermal cell differentiation Biological Process GO:0015031 protein transport Biological Process GO:0048364 root development Biological Process GO:0048468 cell development Biological Process GO:0048731 system development Biological Process
KEGG gene cross-reference	ath:AT5G09810 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.631

Rank 1 · TkA02G161860 · TK1151

Nucleus0.399

Rank 2 · TkA02G161860 · TK1151

Mitochondrion0.065

Rank 3 · TkA02G161860 · TK1151

Cell membrane0.056

Rank 4 · TkA02G161860 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA02G161860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022Actin1-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G161860	`PF00022`	Actin	1	118	7.9e-34	117.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card