TkA02G160430 | RubberDandelionOmics

Gene overview

TkA02G160430

Reference: TK1151 Chr: Chr02 Coordinates: 41149128-41149856 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

636 bp · TkA02G160430|TK1151|cDNA

ATGAACAGCTTTTACGAATTAGAGCCACTGTTTATCGACTATTTGAACCGCGAGTACTCTACCTTCAAAGCTTGGTGCGTGGGACCTCTCTGCCTGGCTGAGTGGTCAACAATCGGAGTTCCAATTCCAGACGCTGACGATCGGAAACCCAAATGGGTGGGGTGGCTAGACCAAAAGCTATCTCAAGGATGCTCTGTTTTATATGTGGCATTCGGTAGTCAAGTTGAGATGTCGACACCACAGGATCTACAGGAAAAAGT...

CDS

Download CDS FASTA

636 bp · TkA02G160430|TK1151|CDS

ATGAACAGCTTTTACGAATTAGAGCCACTGTTTATCGACTATTTGAACCGCGAGTACTCTACCTTCAAAGCTTGGTGCGTGGGACCTCTCTGCCTGGCTGAGTGGTCAACAATCGGAGTTCCAATTCCAGACGCTGACGATCGGAAACCCAAATGGGTGGGGTGGCTAGACCAAAAGCTATCTCAAGGATGCTCTGTTTTATATGTGGCATTCGGTAGTCAAGTTGAGATGTCGACACCACAGGATCTACAGGAAAAAGT...

Protein

Download Protein FASTA

211 aa · TkA02G160430|TK1151|PROTEIN

MNSFYELEPLFIDYLNREYSTFKAWCVGPLCLAEWSTIGVPIPDADDRKPKWVGWLDQKLSQGCSVLYVAFGSQVEMSTPQDLQEKVGERGIIVREWVDQREILKHESVKGFVSHCGLNSVMESICSEVPILAWPMMADQHLNARMVVEEIKIGLRVETCDGSVRGFVKSEGLKKMVKELMEGERGKEVRKKVMEVGKAAKAAMAEDGSSG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G160430`
TK1151 ID	TkA02G160430
OH-1004 ID	LXL04_011099
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.400
Protein coverage (%)	TK1151 100.000 / OH-1004 47.638 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G160430

Location Chr02:41149128-41149856 (-)

Description Similar to UGT90A1: UDP-glycosyltransferase 90A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16890`	UDP-glycosyltransferase 90A1.	No verified direct reference in this release
`At1g10400`	UDP-glycosyltransferase 90A2.	No verified direct reference in this release
`At2g30150`	UDP-glycosyltransferase 87A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011099 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016134 saponin metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050004 isoflavone 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10400

ath:AT2G16890

gmx:100101902

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.422

Rank 1 · TkA02G160430 · TK1151

Cytoplasm0.366

Rank 2 · TkA02G160430 · TK1151

Nucleus0.084

Rank 3 · TkA02G160430 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA02G160430 · TK1151

Mitochondrion0.064

Rank 5 · TkA02G160430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT80-188 aa

PF13528Glyco_trans_1_381-160 aa

PF06722EryCIII-like_C96-155 aa

PF21228RuBisCO_activase_AAA_helical106-127 aa

PF21228RuBisCO_activase_AAA_helical155-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G160430	`PF00201`	UDPGT	80	188	1.2e-15	58.1
TkA02G160430	`PF13528`	Glyco_trans_1_3	81	160	0.31	10.9
TkA02G160430	`PF06722`	EryCIII-like_C	96	155	0.056	14.1
TkA02G160430	`PF21228`	RuBisCO_activase_AAA_helical	106	127	0.034	15.2
TkA02G160430	`PF21228`	RuBisCO_activase_AAA_helical	155	189	0.034	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVX4`	Arabidopsis thaliana	sp\|Q9ZVX4\|U90A1_ARATH UDP-glycosyltransferase 90A1	53.600%	Swiss-Prot	High
`Q9SY84`	Arabidopsis thaliana	sp\|Q9SY84\|U90A2_ARATH UDP-glycosyltransferase 90A2	47.400%	Swiss-Prot	Medium
`O64732`	Arabidopsis thaliana	sp\|O64732\|U87A1_ARATH UDP-glycosyltransferase 87A1	33.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card