TkA02G159710 | RubberDandelionOmics

Gene overview

TkA02G159710

Reference: TK1151 Chr: Chr02 Coordinates: 40952562-40956494 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2826 bp · TkA02G159710|TK1151|cDNA

AATAAAGCAAACTTGTCAAAAATAATAAAAAATTGGAACCAGAAAAACAAATCTATTCAGCAAAAGGGTATTCAACTCATTATCAAACCGATGCAAGATAACGTCGGAAAGTGATTCTTAGCCTGAAAATTGCGTCGTGTTTCTCTGCGTCATCGTCTGTATCTCCGACTTTCGATCTGATTAACTACCTGATCGAGTCCTTTCACCAGATCGATCCCTGTTTGTCCCTGCGGTTTCCACTCTCCTGATCTTCCGTTTTC...

CDS

Download CDS FASTA

1050 bp · TkA02G159710|TK1151|CDS

ATGTTTAGTTATATGATGTTTTTTATATATTTTGTTTATAATGCAGCAAAGATGTCATCCTTCCCATTCAAAGGAGCTCCAATAGGTCTACGAAAACATATGCAAAGACTACTACAAAGACGTACTACTGAACCATCTACCCCGCCCCCACAGACTAGTACTACATCAGCCCCATTTGTAACACCTTCAACCACAACCCCATCTTCAACACCCTCAACCATAGCAACCCCATCTTCAACACCCTCAACCCCAACAACCCC...

Protein

Download Protein FASTA

349 aa · TkA02G159710|TK1151|PROTEIN

MFSYMMFFIYFVYNAAKMSSFPFKGAPIGLRKHMQRLLQRRTTEPSTPPPQTSTTSAPFVTPSTTTPSSTPSTIATPSSTPSTPTTPSHPPSSIPAPSVQVVNDQQQTHVDGRLHIQVDGKELEPSGKCAYIIRRAFIDRVDLEGYKWVNISEATKDFYWEEFQKKCYWDAEDDGSVKTAWEHKNRRKGVEGGTAPPTHNGGSASHKQIAADMEECMGRPPSLYELFMFTHTEDHDGKTLVNDRAKQVHAFYESQRADSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G159710`
TK1151 ID	TkA02G159710
OH-1004 ID	LXL04_024862
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.500
Protein coverage (%)	TK1151 24.069 / OH-1004 32.107 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G159710`
Location	Chr02:40952562-40956494 (-)
Description	Similar to SPCC1672.07: U3 small nucleolar RNA-associated protein 21 homolog (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024862` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0032153 cell division site Cellular Component GO:0034388 Pwp2p-containing subcomplex of 90S preribosome Cellular Component GO:0072686 mitotic spindle Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	hsa:134430 spo:2539299 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · TkA02G159710 · TK1151

Cytoplasm0.210

Rank 2 · TkA02G159710 · TK1151

Mitochondrion0.020

Rank 3 · TkA02G159710 · TK1151

Cell membrane0.016

Rank 4 · TkA02G159710 · TK1151

Extracellular0.009

Rank 5 · TkA02G159710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06333Med13_C40-134 aa

PF27998ArabinogalactanP42-99 aa

PF21827New_glue52-89 aa

PF22384PBP2_Ca3427_like153-173 aa

PF03004Transposase_24182-293 aa

PF04740LXG235-278 aa

PF19111DUF5798241-270 aa

PF22384PBP2_Ca3427_like287-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G159710	`PF06333`	Med13_C	40	134	0.13	12.2
TkA02G159710	`PF27998`	ArabinogalactanP	42	99	0.0035	18.3
TkA02G159710	`PF21827`	New_glue	52	89	2.8	8.5
TkA02G159710	`PF22384`	PBP2_Ca3427_like	153	173	0.23	12.6
TkA02G159710	`PF03004`	Transposase_24	182	293	1.5e-17	64.7
TkA02G159710	`PF04740`	LXG	235	278	1.1	9.8
TkA02G159710	`PF19111`	DUF5798	241	270	3.2	8.7
TkA02G159710	`PF22384`	PBP2_Ca3427_like	287	333	0.23	12.6
TkA02G159710	`PF15960`	DUF4763	311	348	0.17	11.8
TkA02G159710	`PF08581`	Tup_N	313	345	0.0016	19.4
TkA02G159710	`PF27605`	ODF2_C	313	348	0.013	15.4
TkA02G159710	`PF04740`	LXG	313	345	1.1	9.8
TkA02G159710	`PF19111`	DUF5798	314	348	3.2	8.7
TkA02G159710	`PF03004`	Transposase_24	320	338	1.5e-17	64.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card