TkA02G154650 | RubberDandelionOmics

Gene overview

TkA02G154650

Reference: TK1151 Chr: Chr02 Coordinates: 39711690-39719073 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · TkA02G154650|TK1151|cDNA

GTAGAACCCGACCACGGGATTTAGTAAATAGGATAATGTTATTGGAGATGTATCAGCTTTGTAGGATTCGATTAGATTTATTTTTTTACAGGTTGGGAGCCTTTCCACTTCTATGAAGTTTGGCAAGGACTGTAGCTTTCTGTCAATTTCTGGTTCTCTGTTCCACATTTACACCTCTATTGCTCTACTTCAATCCAAATATTTCCGGCGAACGCTGCTGTGTCGGAGCGTACAGAATCACTTCTCTCACTCCACTCCGA...

CDS

Download CDS FASTA

663 bp · TkA02G154650|TK1151|CDS

ATGCTATTATCGAGTTGTTCATCTAACTGTAAATGTGATAATTCATGCCTAAATAAACCATTTCACAGAAGGCCAATGAAGAAAATGAAGATAGTACAGACTGAAAAATGTGGGTCAGGGGTTGTTGCTGAGGAGAATATAAGGCACGGGGAGTTTATAATTGAATATGTTGGAGAAGTTATCGATGACAAAACTTGTGAAGAAAGACTATGGAGAATGAAACGACAAGGTGAAACAAACTTTTACTTATGTGAAATAAA...

Protein

Download Protein FASTA

220 aa · TkA02G154650|TK1151|PROTEIN

MLLSSCSSNCKCDNSCLNKPFHRRPMKKMKIVQTEKCGSGVVAEENIRHGEFIIEYVGEVIDDKTCEERLWRMKRQGETNFYLCEINRDMVIDATFKGNQSRYINHSCSPNTEMQKWRIDGETRIGIFATRNIKKGEHLTYDYQFVQFGADQDCHCGAKGCRQKLGAKPNKSKFPSSDAALKIVACQLRSRMQDRCDKKQNKTRKCDLVIRNKIRLENVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G154650`
TK1151 ID	TkA02G154650
OH-1004 ID	LXL04_016334
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 85.455 / OH-1004 36.015 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G154650

Location Chr02:39711690-39719073 (+)

Description Similar to ASHH3: Histone-lysine N-methyltransferase ASHH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44150`	Histone methyltransferase.	No verified direct reference in this release
`At3g59960`	Histone methyltransferase.	No verified direct reference in this release
`At4g30860`	Histone methyltransferase (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0007281 germ cell development Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010569 regulation of double-strand break repair via homologous recombination Biological Process

GO:0010793 regulation of mRNA export from nucleus Biological Process

GO:0018023 peptidyl-lysine trimethylation Biological Process

KEGG gene cross-reference

ath:AT2G44150

ath:AT4G30860

dme:Dmel_CG1716

hsa:29072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.781

Rank 1 · TkA02G154650 · TK1151

Cytoplasm0.257

Rank 2 · TkA02G154650 · TK1151

Mitochondrion0.053

Rank 3 · TkA02G154650 · TK1151

Cell membrane0.037

Rank 4 · TkA02G154650 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA02G154650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17907AWS1-24 aa

PF00856SET5-14 aa

PF00856SET38-144 aa

PF17907AWS86-92 aa

PF17907AWS153-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G154650	`PF17907`	AWS	1	24	0.041	14.6
TkA02G154650	`PF00856`	SET	5	14	2.6e-27	96.0
TkA02G154650	`PF00856`	SET	38	144	2.6e-27	96.0
TkA02G154650	`PF17907`	AWS	86	92	0.041	14.6
TkA02G154650	`PF17907`	AWS	153	164	0.041	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945S8`	Arabidopsis thaliana	sp\|Q945S8\|ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3	76.600%	Swiss-Prot	High
`Q9M1X9`	Arabidopsis thaliana	sp\|Q9M1X9\|ASHH4_ARATH Putative histone-lysine N-methyltransferase ASHH4	73.900%	Swiss-Prot	High
`Q949T8`	Arabidopsis thaliana	sp\|Q949T8\|ASHR3_ARATH Histone-lysine N-methyltransferase ASHR3	56.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card