TkA02G150360 | RubberDandelionOmics

Gene overview

TkA02G150360

Reference: TK1151 Chr: Chr02 Coordinates: 38714311-38715450 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

756 bp · TkA02G150360|TK1151|cDNA

ATGAGAGGAGGAGGAGGGCGGTCCCCATGCTGTGACAAGAATAAGGTGAAGAAAGGGCCGTGGAGTCCGGTGGAGGACGTCAGGCTCGTAGCCTTTATTCAGAAACATGGTCATTCTAATTGGCGTTCTCTCCCAAAACAAGCCGGTTTGCTAAGATGTGGAAAGAGCTGCCGCCTGAGATGGATAAATTATCTAAGGCCTGACCTCAAGAGAGGCAATTTTACTCCCCAAGAAGAGCATTCCATAATTCGTCTTCACGC...

CDS

Download CDS FASTA

756 bp · TkA02G150360|TK1151|CDS

ATGAGAGGAGGAGGAGGGCGGTCCCCATGCTGTGACAAGAATAAGGTGAAGAAAGGGCCGTGGAGTCCGGTGGAGGACGTCAGGCTCGTAGCCTTTATTCAGAAACATGGTCATTCTAATTGGCGTTCTCTCCCAAAACAAGCCGGTTTGCTAAGATGTGGAAAGAGCTGCCGCCTGAGATGGATAAATTATCTAAGGCCTGACCTCAAGAGAGGCAATTTTACTCCCCAAGAAGAGCATTCCATAATTCGTCTTCACGC...

Protein

Download Protein FASTA

251 aa · TkA02G150360|TK1151|PROTEIN

MRGGGGRSPCCDKNKVKKGPWSPVEDVRLVAFIQKHGHSNWRSLPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTPQEEHSIIRLHATFGNKWSKIASKLPGRTDNEIKNVWNTHLKKRSVLMNKNESFFLGTNQPHKVIDGEEAARDKLVDQPSTSSSTVSCNTHDEVNLEIPEFELWNMLEDIELPYSKPIADHDPNGSMDLDHRVRLLEEELGLVGVTPAVVGDNSEMWCKISLFRWKQCFISQQVTY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G150360`
TK1151 ID	TkA02G150360
OH-1004 ID	LXL04_016363
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.600
Protein coverage (%)	TK1151 91.633 / OH-1004 90.157 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G150360

Location Chr02:38714311-38715450 (-)

Description Similar to MYB63: Transcription factor MYB63

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79180`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321
`At1g56160`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	Expression differences for genes involved in lignin, glutathione and sulphate metabolism in response to cadmium in Arabidopsis thaliana and the related Zn/Cd-hyperaccumulator Thlaspi caerulescens.2008 · DOI: 10.1111/j.1365-3040.2007.01764.x MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.2008 · DOI: 10.1104/pp.107.113829 MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe.2009 · DOI: 10.1111/j.1438-8677.2008.00162.x β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots.2014 · DOI: 10.1111/nph.12980
`At1g16490`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321
`At2g31180`	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes.	AtMYB14 Regulates Cold Tolerance in Arabidopsis. 2013 · DOI: 10.1007/s11105-012-0481-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009411 response to UV Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009866 induced systemic resistance, ethylene mediated signaling pathway Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0019748 secondary metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G16490

ath:AT1G56160

ath:AT1G79180

ath:AT2G31180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA02G150360 · TK1151

Cytoplasm0.108

Rank 2 · TkA02G150360 · TK1151

Cell membrane0.025

Rank 3 · TkA02G150360 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA02G150360 · TK1151

Mitochondrion0.012

Rank 5 · TkA02G150360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_715-37 aa

PF00249Myb_DNA-binding18-65 aa

PF13921Myb_DNA-bind_621-80 aa

PF23588HTH_CHD1_Hrp321-44 aa

PF00249Myb_DNA-binding71-116 aa

PF13921Myb_DNA-bind_674-118 aa

PF15963Myb_DNA-bind_780-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G150360	`PF15963`	Myb_DNA-bind_7	15	37	0.13	12.8
TkA02G150360	`PF00249`	Myb_DNA-binding	18	65	2.8e-35	120.9
TkA02G150360	`PF13921`	Myb_DNA-bind_6	21	80	3.3e-19	69.6
TkA02G150360	`PF23588`	HTH_CHD1_Hrp3	21	44	0.061	14.0
TkA02G150360	`PF00249`	Myb_DNA-binding	71	116	2.8e-35	120.9
TkA02G150360	`PF13921`	Myb_DNA-bind_6	74	118	3.3e-19	69.6
TkA02G150360	`PF15963`	Myb_DNA-bind_7	80	125	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6R0A6`	Arabidopsis thaliana	sp\|Q6R0A6\|MYB63_ARATH Transcription factor MYB63	81.000%	Swiss-Prot	Low
`Q9SGU3`	Arabidopsis thaliana	sp\|Q9SGU3\|MYB72_ARATH Transcription factor MYB72	55.800%	Swiss-Prot	High
`Q9SA47`	Arabidopsis thaliana	sp\|Q9SA47\|MYB58_ARATH Transcription factor MYB58	80.200%	Swiss-Prot	Low
`Q9SJX8`	Arabidopsis thaliana	sp\|Q9SJX8\|MYB14_ARATH Transcription factor MYB14	75.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card