TkA02G142310 | RubberDandelionOmics

Gene overview

TkA02G142310

Reference: TK1151 Chr: Chr02 Coordinates: 36756431-36761367 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3243 bp · TkA02G142310|TK1151|cDNA

GTACAAGTTCTTATTGCTCTAGAAAAAGGTTTTACCGGAACATTAGGGACAAGCGGCACCCCGTGAGCGGCACATCTCCCTAACCCTTTGTCTTACGAGTTCGGCGAATCCGACGAACCCGTACCATCGCCTCCACAATCCCACCGATTCCCCAATCGCCTCTACACAAGAAAATCATCGGACCGTCATGTTCGACCGCCGGCGACGGCCAGGGCGACAACAACAATGAAGATGATTCAGTGCTTCAGCTGGTGAAAATG...

CDS

Download CDS FASTA

1881 bp · TkA02G142310|TK1151|CDS

ATGGCCTTGTCGAGGTCGTTAACTGTTGGCAACATTAGAAGGGCAGCACATTCCCTTTTTCCAACCCGTAACAACCTTTTCTTTGAAGTCAAAACTCATAGACTCAAATTAACCGTTCCCTTTCACCACTCCTACAGACTCTATTCACATTATAACTTTCTCAACAAAAACCTGACTTGTTATACATTCCATGAAGCAAAAAAAACTTCATGGAGTTGTAGAAATTTCCAAAGATTCTATTTCATATCAGCAACTTCCAA...

Protein

Download Protein FASTA

626 aa · TkA02G142310|TK1151|PROTEIN

MALSRSLTVGNIRRAAHSLFPTRNNLFFEVKTHRLKLTVPFHHSYRLYSHYNFLNKNLTCYTFHEAKKTSWSCRNFQRFYFISATSKVSHHAQIAWKRVFHICTYNVPHLPMNRITCAVSFALSRSQLIGPGILAFLVGEFARTQSLAEAEGFYKNDLFTQDGHVYITSFIFSILELVILCLRAIYLSFLFTPCIAMAPFADSFGPNFRTAWLQCLHRTLEKAGPAFIKWGQWAASRPDLFPNDLCLELSELQTKAPAHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G142310`
TK1151 ID	TkA02G142310
OH-1004 ID	LXL04_016434
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 90.895 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G142310`
Location	Chr02:36756431-36761367 (+)
Description	Similar to abkC: Probable serine/threonine-protein kinase abkC
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016434` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007005 mitochondrion organization Biological Process GO:0010795 regulation of ubiquinone biosynthetic process Biological Process GO:0055091 phospholipid homeostasis Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0044289 mitochondrial inner-outer membrane contact site Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016301 kinase activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0267774 hsa:90956 mmu:57869 sce:YPL109C spo:2540293 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.881

Rank 1 · TkA02G142310 · TK1151

Cytoplasm0.067

Rank 2 · TkA02G142310 · TK1151

Plastid0.056

Rank 3 · TkA02G142310 · TK1151

Nucleus0.047

Rank 4 · TkA02G142310 · TK1151

Cell membrane0.035

Rank 5 · TkA02G142310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC1252-515 aa

PF01636APH316-369 aa

PF01636APH449-468 aa

PF27536UbiB_helical555-598 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G142310	`PF03109`	ABC1	252	515	2.3e-45	155.4
TkA02G142310	`PF01636`	APH	316	369	0.074	13.5
TkA02G142310	`PF01636`	APH	449	468	0.074	13.5
TkA02G142310	`PF27536`	UbiB_helical	555	598	0.012	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card