TkA02G140530 | RubberDandelionOmics

Gene overview

TkA02G140530

Reference: TK1151 Chr: Chr02 Coordinates: 36259964-36261508 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1046 bp · TkA02G140530|TK1151|cDNA

GTTCCTCATTACCATATGATCACAGTTCCTCCATTTATCCAACGAGTTCCTTCTCTTCTAGTTCCTTTTATACTTTCTACACATGAAATGATATCCCATCAATCCAAAACAATCATGTGTAATCACACATTTCCGACGGCCGGCGATTACGGTAATCTGGATTATTCACCCAGATTGTGGGTTTGTGTTCTTCGGGTCTGTCATAAATTACATTCCATATTTTCCCTTTCTTGGATTCTTTTAAGCAAACGGGTTCCAAG...

CDS

Download CDS FASTA

645 bp · TkA02G140530|TK1151|CDS

ATGTCTTCTTCACCATCGAACAAGTCTTGCGTCCATTGCAATGACTCTTCATCCGATTGCTTCAATAATGGCTGGAAACTCCACAGTGGTGAGCACGCACAGCTCTGCGATCGTTGCTTTGGTTTCTACAATCTGGGCCGATTCTGTGAAGCATTTCATTCCGAAGAAGATGGCTGGAGGGACTGTGCGTCTTGTGGGAAGCTTGTTCATTGTGGATGTATTGTCTCTCTCGATGACTACTCACTCCTGGATTCCAATGG...

Protein

Download Protein FASTA

214 aa · TkA02G140530|TK1151|PROTEIN

MSSSPSNKSCVHCNDSSSDCFNNGWKLHSGEHAQLCDRCFGFYNLGRFCEAFHSEEDGWRDCASCGKLVHCGCIVSLDDYSLLDSNGIICINCSRTNCNITPESEPALIPLFEKVLTNSDSNSKFGRIIIPKKHAEAYFPKVSESQEIPLSVMDTEGNEWNLYFRSWAHKYSKMYHLKGIRDFLLLNNLQSGDTVAFYGDESDGKIVMEARKSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G140530`
TK1151 ID	TkA02G140530
OH-1004 ID	LXL04_016443
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G140530

Location Chr02:36259964-36261508 (-)

Description Similar to VAL2: B3 domain-containing transcription repressor VAL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21550`	May be involved in plant development.	Repression of the LEAFY COTYLEDON 1/B3 regulatory network in plant embryo development by VP1/ABSCISIC ACID INSENSITIVE 3-LIKE B3 genes.2007 · DOI: 10.1104/pp.106.092320
`At4g32010`	Transcriptional repressor of gene expression involved in embryonic pathways, such as LEC1, ABI3, and FUS3.	Repression of the LEAFY COTYLEDON 1/B3 regulatory network in plant embryo development by VP1/ABSCISIC ACID INSENSITIVE 3-LIKE B3 genes.2007 · DOI: 10.1104/pp.106.092320
`At2g30470`	Transcriptional repressor of gene expression involved in embryonic pathways, such as LEC1, ABI3, and FUS3.	Analysis of a sugar response mutant of Arabidopsis identified a novel B3 domain protein that functions as an active transcriptional repressor.2005 · DOI: 10.1104/pp.104.057752 Repression of the LEAFY COTYLEDON 1/B3 regulatory network in plant embryo development by VP1/ABSCISIC ACID INSENSITIVE 3-LIKE B3 genes.2007 · DOI: 10.1104/pp.106.092320 Two B3 domain transcriptional repressors prevent sugar-inducible expression of seed maturation genes in Arabidopsis seedlings.2007 · DOI: 10.1073/pnas.0607940104

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0563300`	B3 domain-containing protein Os07g0563300.	No verified direct reference in this release
`Os01g0713600`	Transcription repressor involved in flowering time regulation.	Ectopic expression of OsLFL1 in rice represses Ehd1 by binding on its promoter.2007 · DOI: 10.1016/j.bbrc.2007.06.041 Overexpression of transcription factor OsLFL1 delays flowering time in Oryza sativa.2008 · DOI: 10.1016/j.jplph.2007.07.010

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016443 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G32010

dosa:Os07g0563300

dosa:Os07g0679700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · TkA02G140530 · TK1151

Cytoplasm0.155

Rank 2 · TkA02G140530 · TK1151

Cell membrane0.022

Rank 3 · TkA02G140530 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA02G140530 · TK1151

Plastid0.010

Rank 5 · TkA02G140530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25813zf_VAL1_N10-16 aa

PF02362B313-26 aa

PF25813zf_VAL1_N52-97 aa

PF02362B3112-211 aa

PF31239At5g26805_C133-204 aa

PF03754At2g31720-like148-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G140530	`PF25813`	zf_VAL1_N	10	16	5.5e-20	71.8
TkA02G140530	`PF02362`	B3	13	26	5.8e-14	52.6
TkA02G140530	`PF25813`	zf_VAL1_N	52	97	5.5e-20	71.8
TkA02G140530	`PF02362`	B3	112	211	5.8e-14	52.6
TkA02G140530	`PF31239`	At5g26805_C	133	204	0.0095	17.2
TkA02G140530	`PF03754`	At2g31720-like	148	204	0.056	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65420`	Arabidopsis thaliana	sp\|O65420\|VAL3_ARATH B3 domain-containing transcription factor VAL3	38.300%	Swiss-Prot	Medium
`Q5CCK4`	Arabidopsis thaliana	sp\|Q5CCK4\|VAL2_ARATH B3 domain-containing transcription repressor VAL2	43.000%	Swiss-Prot	Low
`Q8W4L5`	Arabidopsis thaliana	sp\|Q8W4L5\|VAL1_ARATH B3 domain-containing transcription repressor VAL1	37.100%	Swiss-Prot	Medium
`Q0D5G4`	Oryza sativa subsp. japonica	sp\|Q0D5G4\|Y7633_ORYSJ B3 domain-containing protein Os07g0563300	42.600%	Swiss-Prot	Medium
`A4LBC0`	Oryza sativa subsp. japonica	sp\|A4LBC0\|LFL1_ORYSJ B3 domain-containing protein LFL1	34.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card