TkA02G135880 | RubberDandelionOmics

Gene overview

TkA02G135880

Reference: TK1151 Chr: Chr02 Coordinates: 35105921-35108257 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1986 bp · TkA02G135880|TK1151|cDNA

ATTTCCTAGGTCAAATAGTCACGTCTGGGGATCGATCTCCCCAACGCGCCTCCTACCTCTTCTTGCGTCTAATCCGTCACCCTCAGTCCTTTGGCGCCTGAATTTGGCGCTTAAATTCCCCTCGTCCTCGGCCATAGGGTCGGCCATGGTCTTCGTCGTCTCGGCCGTTTGGGGGTGACTCACCCTTCGGCCATCTGTCAAGGGAGGGAGTAAATGGTAAAATTACACCTCCCTCATTATCCATCATCTCAACCAGTATC...

CDS

Download CDS FASTA

1176 bp · TkA02G135880|TK1151|CDS

ATGGTAAAATTACACCTCCCTCATTATCCATCATCTCAACCAGTATCGAATCAGACCACAATCGCGTTTCCACCATCGCAACAAGATTCGAACCAGATCACAACTGGATCTAACTCAGCTTCTCAAGAAAGATCAAACAAGACCTCGATAGTGAATTTACCGTCTCAATCAGTAACGAATCAGACGATCAATATAGTGCCGAATTCAGCTTCAGAGTCGCAGAAATCAGTACCGAGCAATGCTACTGAAAATATGGCGAA...

Protein

Download Protein FASTA

391 aa · TkA02G135880|TK1151|PROTEIN

MVKLHLPHYPSSQPVSNQTTIAFPPSQQDSNQITTGSNSASQERSNKTSIVNLPSQSVTNQTINIVPNSASESQKSVPSNATENMAKPSPNSGKSMPEAGGNGAGSGPGQRSEDKVNAKNVTSLGKKQGTDDLVKSLVNCNLFDGDWVRDESYPLYKPGSCSLIDEQFNCFANGRPDLGFQNYKWKPNGCSLPRLDGSKMLKLLKGKRLVFVGDSLNRNMWESLVCILRNSVKDQTKVYEASGRHHFRAEASYSFVFKDY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G135880`
TK1151 ID	TkA02G135880
OH-1004 ID	LXL04_016480
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 93.095 / OH-1004 44.015 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G135880

Location Chr02:35105921-35108257 (+)

Description Similar to TBR: Protein trichome birefringence

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06700`	Required during cellulose deposition.	No verified direct reference in this release
`At3g12060`	Can complement TBR and is therefore functionally equivalent, but may work in different tissue.	No verified direct reference in this release
`At1g60790`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g49340`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g62390`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016480 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60790

ath:AT3G12060

ath:AT5G06700

ath:AT5G20590

ath:AT5G49340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.332

Rank 1 · TkA02G135880 · TK1151

Extracellular0.214

Rank 2 · TkA02G135880 · TK1151

Cell membrane0.195

Rank 3 · TkA02G135880 · TK1151

Endoplasmic reticulum0.117

Rank 4 · TkA02G135880 · TK1151

Cytoplasm0.065

Rank 5 · TkA02G135880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10428SOG26-122 aa

PF14416PMR5N139-191 aa

PF24536NXPE4_C185-242 aa

PF13839PC-Esterase192-350 aa

PF14416PMR5N311-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G135880	`PF10428`	SOG2	6	122	7.6	6.6
TkA02G135880	`PF14416`	PMR5N	139	191	2.2e-22	79.9
TkA02G135880	`PF24536`	NXPE4_C	185	242	0.00029	21.2
TkA02G135880	`PF13839`	PC-Esterase	192	350	1.3e-50	173.6
TkA02G135880	`PF14416`	PMR5N	311	329	2.2e-22	79.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG35`	Arabidopsis thaliana	sp\|Q9FG35\|TBR_ARATH Protein trichome birefringence	73.300%	Swiss-Prot	Medium
`Q9LHL6`	Arabidopsis thaliana	sp\|Q9LHL6\|TBL1_ARATH Protein trichome birefringence-like 1	69.000%	Swiss-Prot	Medium
`Q8VYR3`	Arabidopsis thaliana	sp\|Q8VYR3\|TBL2_ARATH Protein trichome birefringence-like 2	56.200%	Swiss-Prot	Medium
`Q9FJ06`	Arabidopsis thaliana	sp\|Q9FJ06\|TBL4_ARATH Protein trichome birefringence-like 4	55.000%	Swiss-Prot	Medium
`Q9LZQ1`	Arabidopsis thaliana	sp\|Q9LZQ1\|TBL6_ARATH Protein trichome birefringence-like 6	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card