TkA02G135350 | RubberDandelionOmics

Gene overview

TkA02G135350

Reference: TK1151 Chr: Chr02 Coordinates: 34978197-34980083 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1268 bp · TkA02G135350|TK1151|cDNA

CACCACCACCACCAAAACCTTCACACATCCACCCAACAATGGTGCTTTCAACAAACACAAGAGTCGAAAGCCTATCAAAAAGCGGAATTCACCAAATCCCAAAAGAGTACATCCGTCCACAAGATGAACTCCCAACCATCACCAACATCTTGGACGAAACCACCAACGATCAAGGGCCACAACTCCCCACCATCGACTTAAACGACATCAATTCCGACGACCCCAAAACCCTAGAAAACTGTCGCAACGAGCTCCGGAAA...

CDS

Download CDS FASTA

1068 bp · TkA02G135350|TK1151|CDS

ATGGTGCTTTCAACAAACACAAGAGTCGAAAGCCTATCAAAAAGCGGAATTCACCAAATCCCAAAAGAGTACATCCGTCCACAAGATGAACTCCCAACCATCACCAACATCTTGGACGAAACCACCAACGATCAAGGGCCACAACTCCCCACCATCGACTTAAACGACATCAATTCCGACGACCCCAAAACCCTAGAAAACTGTCGCAACGAGCTCCGGAAAGCCGCCACCGACTGGGGCGTCATGCACCTCATCAACCA...

Protein

Download Protein FASTA

355 aa · TkA02G135350|TK1151|PROTEIN

MVLSTNTRVESLSKSGIHQIPKEYIRPQDELPTITNILDETTNDQGPQLPTIDLNDINSDDPKTLENCRNELRKAATDWGVMHLINHGISDDLIARVKAAGESFFGLPVEEKEKHCNDIAVGKIQGYGSKLANNASGQLEWEDYFFHTVFPEEKRDLTVWPTTPSDYISATAEYAKKIRALTTKILSVLSLGLGLEAGRLEEEVGGADELLLQLKINYYPKCPQPELALGVEAHTDLCALTFILHNMVPGLQLFYGGQWV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G135350`
TK1151 ID	TkA02G135350
OH-1004 ID	LXL04_016484
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G135350

Location Chr02:34978197-34980083 (+)

Description Similar to ANS: Leucoanthocyanidin dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22880`	Involved in anthocyanin and protoanthocyanidin biosynthesis by catalyzing the oxidation of leucoanthocyanidins into anthocyanidins.	The Arabidopsis TDS4 gene encodes leucoanthocyanidin dioxygenase (LDOX) and is essential for proanthocyanidin synthesis and vacuole development.2003 · DOI: 10.1046/j.1365-313x.2003.01834.x Arabidopsis thaliana expresses a second functional flavonol synthase.2009 · DOI: 10.1016/j.febslet.2009.05.006 Leucoanthocyanidin Dioxygenase in Arabidopsis thaliana: characterization of mutant alleles and regulation by MYB-BHLH-TTG1 transcription factor complexes.2011 · DOI: 10.1016/j.gene.2011.05.031

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016484 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0007033 vacuole organization Biological Process

GO:0009611 response to wounding Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010023 proanthocyanidin biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050498 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, with 2-oxoglutarate as one donor, and the other dehydrogenated Molecular Function

KEGG gene cross-reference

ag:BAA20143

ath:AT4G22880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.818

Rank 1 · TkA02G135350 · TK1151

Nucleus0.314

Rank 2 · TkA02G135350 · TK1151

Peroxisome0.057

Rank 3 · TkA02G135350 · TK1151

Mitochondrion0.056

Rank 4 · TkA02G135350 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA02G135350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N49-162 aa

PF21748UPF015063-84 aa

PF031712OG-FeII_Oxy214-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G135350	`PF14226`	DIOX_N	49	162	2.3e-23	83.8
TkA02G135350	`PF21748`	UPF0150	63	84	0.13	12.9
TkA02G135350	`PF03171`	2OG-FeII_Oxy	214	309	9.3e-30	103.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96323`	Arabidopsis thaliana	sp\|Q96323\|LDOX_ARATH Leucoanthocyanidin dioxygenase	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card