TkA02G134750 | RubberDandelionOmics

Gene overview

TkA02G134750

Reference: TK1151 Chr: Chr02 Coordinates: 34804892-34810220 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2244 bp · TkA02G134750|TK1151|cDNA

GTGAATCCAAAATGATAGAATTGTCCGAATTCCAAAATGTCTTTCCCGTATTCCCCAATCTGGTAAAACATAAGCTATTTGGTTAGACTCGACCGAACGAATCAAGAGGCAAAATCATGAATCTTCGATCGATGTTCAAATAACCTGATCGTGTTACTCTTATGTTGTCGGCTGCGAAGTAGTTAGAGAAATAGATCAATGGAGCGAATGCTAAAAGCCGCCAGAGCGTCTGGCTCTCTCAATCTATCAAATCGCTCTCT...

CDS

Download CDS FASTA

1755 bp · TkA02G134750|TK1151|CDS

ATGGAGCGAATGCTAAAAGCCGCCAGAGCGTCTGGCTCTCTCAATCTATCAAATCGCTCTCTCAAGGAAGTACCTGATGAGGTATACAAGAGTTTGGATGCAGTTGGTGAAGGTGAAAATTGGTGGGAGGCAGTTGAGTTACAAAAGCTGATATTAGCTCATAATGAGATTGAATTGCTAAAAGAAGACATAAGAAACTTACCAATGTTATCTGTACTAAATATCAGCCACAACAAGCTTTCCCACCTTCCAGCTGCTAT...

Protein

Download Protein FASTA

584 aa · TkA02G134750|TK1151|PROTEIN

MERMLKAARASGSLNLSNRSLKEVPDEVYKSLDAVGEGENWWEAVELQKLILAHNEIELLKEDIRNLPMLSVLNISHNKLSHLPAAIGELKSLKALDVSSNLLREIPEEIGSVTSLIKFDCSSNQLKDLPCSLGDCQALSDLKASNNSLISLPEDLSNCSKMFKLDLEGNKLTALSDKLVASWTSITEINAAKNTLNGVPESIGGLSRLIRLDLHQNKISLIPSSIKGCSLLAEFYIGNNFLTSLPAEIGQLTNLGTFDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G134750`
TK1151 ID	TkA02G134750
OH-1004 ID	LXL04_016488
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G134750

Location Chr02:34804892-34810220 (+)

Description Similar to IRL6: Plant intracellular Ras-group-related LRR protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0826600`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016488 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0035556 intracellular signal transduction Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

dosa:Os02g0826600

gga:424713

hsa:55631

xla:444098

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.691

Rank 1 · TkA02G134750 · TK1151

Nucleus0.321

Rank 2 · TkA02G134750 · TK1151

Cell membrane0.092

Rank 3 · TkA02G134750 · TK1151

Golgi apparatus0.074

Rank 4 · TkA02G134750 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA02G134750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24048LRR_NXF1-512-23 aa

PF13855LRR_813-33 aa

PF00560LRR_113-27 aa

PF12799LRR_414-26 aa

PF29252LRR_NLRC443-90 aa

PF13855LRR_846-103 aa

PF12799LRR_446-84 aa

PF00560LRR_147-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G134750	`PF24048`	LRR_NXF1-5	12	23	0.013	15.8
TkA02G134750	`PF13855`	LRR_8	13	33	1.2e-49	166.6
TkA02G134750	`PF00560`	LRR_1	13	27	1.9e-28	93.1
TkA02G134750	`PF12799`	LRR_4	14	26	5.8e-38	128.8
TkA02G134750	`PF29252`	LRR_NLRC4	43	90	3.1	7.6
TkA02G134750	`PF13855`	LRR_8	46	103	1.2e-49	166.6
TkA02G134750	`PF12799`	LRR_4	46	84	5.8e-38	128.8
TkA02G134750	`PF00560`	LRR_1	47	67	1.9e-28	93.1
TkA02G134750	`PF14580`	LRR_9	47	100	9.5e-05	22.8
TkA02G134750	`PF13516`	LRR_6	47	57	0.00048	20.7
TkA02G134750	`PF25013`	LRR_Zer-1	55	83	0.052	14.4
TkA02G134750	`PF24048`	LRR_NXF1-5	57	106	0.013	15.8
TkA02G134750	`PF23952`	LRR_EndoS	61	101	0.00078	20.4
TkA02G134750	`PF23598`	LRR_14	62	189	4.4e-30	105.3
TkA02G134750	`PF23286`	LRR_13	67	133	1.8e-08	35.1
TkA02G134750	`PF24758`	LRR_At5g56370	67	101	1.1	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6K7R2`	Oryza sativa subsp. japonica	sp\|Q6K7R2\|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6	68.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card