TkA02G134630 | RubberDandelionOmics

Gene overview

TkA02G134630

Reference: TK1151 Chr: Chr02 Coordinates: 34776069-34779543 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · TkA02G134630|TK1151|cDNA

ATGTCTTCTGAAGGTGCTAAAGAAGACTCCAGATCTTTAGCTTTAACTCCAACAACTTCAATTGCTATAGTTATGACTATCTTTGTTCTTATCTCTGTGTTCCTGGAGCAATCAATTCGTTACTTGAGTAATTGGTTGAAGAAAATGAAACGCAACCCAATGCTTGCAGCAGTTGAGAAAATGAAAGAAGAATTAATGCTTCTTGGCTTTATATCACTACTTCTTGCAGTTACCTCTAGTAGTATATCCAATATTTGTAT...

CDS

Download CDS FASTA

1557 bp · TkA02G134630|TK1151|CDS

ATGTCTTCTGAAGGTGCTAAAGAAGACTCCAGATCTTTAGCTTTAACTCCAACAACTTCAATTGCTATAGTTATGACTATCTTTGTTCTTATCTCTGTGTTCCTGGAGCAATCAATTCGTTACTTGAGTAATTGGTTGAAGAAAATGAAACGCAACCCAATGCTTGCAGCAGTTGAGAAAATGAAAGAAGAATTAATGCTTCTTGGCTTTATATCACTACTTCTTGCAGTTACCTCTAGTAGTATATCCAATATTTGTAT...

Protein

Download Protein FASTA

518 aa · TkA02G134630|TK1151|PROTEIN

MSSEGAKEDSRSLALTPTTSIAIVMTIFVLISVFLEQSIRYLSNWLKKMKRNPMLAAVEKMKEELMLLGFISLLLAVTSSSISNICIPSKFYDNAFSPCSTPDNNQENKDSKSEILNKLNQNMCLKDYEPFVSDEGLEQLHRFIFIIAVTHVLYSCFTMLLAIVKIHQWRIWEDDAQMDPHDVLTEISRSETMRRQSAIVKFHVSNPLVRNGFLTWMICFFRQFGNSVVRADYLTLRKAFIMNHNLTSKFDFHSYMIRSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G134630`
TK1151 ID	TkA02G134630
OH-1004 ID	LXL04_016491
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.500
Protein coverage (%)	TK1151 97.297 / OH-1004 49.893 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G134630

Location Chr02:34776069-34779543 (-)

Description Similar to MLO14: MLO-like protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26700`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At5g53760`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g11000`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At4g24250`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At4g02600`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016491 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G11000

ath:AT1G26700

ath:AT4G02600

ath:AT4G24250

ath:AT5G53760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.811

Rank 1 · TkA02G134630 · TK1151

Endoplasmic reticulum0.113

Rank 2 · TkA02G134630 · TK1151

Cytoplasm0.097

Rank 3 · TkA02G134630 · TK1151

Lysosome / Vacuole0.056

Rank 4 · TkA02G134630 · TK1151

Nucleus0.044

Rank 5 · TkA02G134630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo11-454 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G134630	`PF03094`	Mlo	11	454	7.1e-146	487.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KB1`	Arabidopsis thaliana	sp\|Q94KB1\|MLO14_ARATH MLO-like protein 14	59.200%	Swiss-Prot	High
`Q9FI00`	Arabidopsis thaliana	sp\|Q9FI00\|MLO11_ARATH MLO-like protein 11	59.500%	Swiss-Prot	High
`O23693`	Arabidopsis thaliana	sp\|O23693\|MLO4_ARATH MLO-like protein 4	43.500%	Swiss-Prot	Medium
`Q94KB2`	Arabidopsis thaliana	sp\|Q94KB2\|MLO13_ARATH MLO-like protein 13	39.500%	Swiss-Prot	Medium
`O49621`	Arabidopsis thaliana	sp\|O49621\|MLO1_ARATH MLO-like protein 1	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card