TkA02G130890 | RubberDandelionOmics

Gene overview

TkA02G130890

Reference: TK1151 Chr: Chr02 Coordinates: 33880649-33882952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

935 bp · TkA02G130890|TK1151|cDNA

TTTTAGTAGCTGTCTGACCTCGCTCTGCTATCACTGATCGCTCCTTTGCTGTCGGCGGCGAATTGTCGCCTCTTTTGGCTCGTAGCGCTAAAGGCTCATCCATCGCTCCTTCCAGTCCCAACTCAACATCGCGATTACCACAGAGCATCGCTCCGACTCCATACACGAGCCGTAGTTGCCTAACCTCGTTCTGATATCGCCGATCGTTCCTTTTCTGTCGCCGCATCTGGACGTAGCACTTTAATGACGACGACGGTCTG...

CDS

Download CDS FASTA

378 bp · TkA02G130890|TK1151|CDS

ATGGAAGATGTGAGCATGCTTGCTTTCACCACCGAACAAATTAGTGCCCCTTTCCTCTTACCCGAAATGGTTGAAAGAGTTGGCAGCATGTTGAACTATTTCCTATTACAACTTGTTGACCCTCAAAGAAAATCATTAAGTTTAAAAGACCCTGAAAAATACGAGTTCCGCCCTAAACAGTTGCTAAAACAGATTGTCAACATATATGTCAATCTTGCAAGGGGAGATCACGACAATATTTTCCCATCTGCCATTACAAA...

Protein

Download Protein FASTA

125 aa · TkA02G130890|TK1151|PROTEIN

MEDVSMLAFTTEQISAPFLLPEMVERVGSMLNYFLLQLVDPQRKSLSLKDPEKYEFRPKQLLKQIVNIYVNLARGDHDNIFPSAITKDGRSYNEQVLFFNIITSFLIYYLLLVYRKIYSNGPFVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G130890`
TK1151 ID	TkA02G130890
OH-1004 ID	LXL04_006562
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 76.800 / OH-1004 8.240 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G130890

Location Chr02:33880649-33882952 (+)

Description Similar to PUB1: Probable ubiquitin conjugation factor E4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15400`	Ubiquitin-protein ligase that may function as an E3 ligase in conjunction with specific E1 and E2 ligases.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006457 protein folding Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0009411 response to UV Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT5G15400

hsa:10277

hsa:9354

mmu:63958

spo:2542023

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.441

Rank 1 · TkA02G130890 · TK1151

Nucleus0.439

Rank 2 · TkA02G130890 · TK1151

Endoplasmic reticulum0.080

Rank 3 · TkA02G130890 · TK1151

Mitochondrion0.077

Rank 4 · TkA02G130890 · TK1151

Golgi apparatus0.074

Rank 5 · TkA02G130890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10408Ufd2P_core2-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G130890	`PF10408`	Ufd2P_core	2	97	2.2e-34	119.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF41`	Arabidopsis thaliana	sp\|Q9LF41\|UBE4_ARATH Probable ubiquitin conjugation factor E4	85.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card