TkA02G129680 | RubberDandelionOmics

Gene overview

TkA02G129680

Reference: TK1151 Chr: Chr02 Coordinates: 33593438-33596085 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1040 bp · TkA02G129680|TK1151|cDNA

ATGAAGTTCATCTTTTCCTTGATTAAATACATTTGGAGGTTATGTTACAGGAAGATGCAACCATGTGGTAACAGGAGGCAAAAGAAAGACATATTTATTGCCGTTTATCTCTTTGTATTAGGTCAAAAACCAGTTGAGGAATGCGAGATTATCGAATTGATGCAGCAAATTGATCCCAAAACCAGGAAGCCAATGAAAAAAAAGGTTCTTTTTGTCAAGAATGGAGCTGCTGTCATATGCCGTATTCAGGTGACTAACAT...

CDS

Download CDS FASTA

735 bp · TkA02G129680|TK1151|CDS

ATGAAGTTCATCTTTTCCTTGATTAAATACATTTGGAGGTTATGTTACAGGAAGATGCAACCATGTGGTAACAGGAGGCAAAAGAAAGACATATTTATTGCCGTTTATCTCTTTGTATTAGGTCAAAAACCAGTTGAGGAATGCGAGATTATCGAATTGATGCAGCAAATTGATCCCAAAACCAGGAAGCCAATGAAAAAAAAGGTTCTTTTTGTCAAGAATGGAGCTGCTGTCATATGCCGTATTCAGGTGACTAACAT...

Protein

Download Protein FASTA

244 aa · TkA02G129680|TK1151|PROTEIN

MKFIFSLIKYIWRLCYRKMQPCGNRRQKKDIFIAVYLFVLGQKPVEECEIIELMQQIDPKTRKPMKKKVLFVKNGAAVICRIQVTNMICIEKFSEFQQLGRFTLRTKGQLLEVVLTKPQSDRKSDNSSPHYSGPHPNYIHQNVYGGFSSNPYGGSVGPRYGVTSSFQQPMIYGRGPVPGGMQRVSMVLPDGQIGQQPGAQMPAARPPRRNEWSSSNGYGGARRGGSGGGGGSGGGDDRGRYRPY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G129680`
TK1151 ID	TkA02G129680
OH-1004 ID	LXL04_039661
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.000
Protein coverage (%)	TK1151 86.885 / OH-1004 89.362 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G129680

Location Chr02:33593438-33596085 (-)

Description Similar to LIF2: Heterogeneous nuclear ribonucleoprotein Q

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00830`	Transcriptional activator that binds DNA on GAGA-like motif and 5'-(C/G)ACGTG(G/T)C(A/G)-3' consensus motif in the promoters of target genes.	Control of flowering and cell fate by LIF2, an RNA binding partner of the polycomb complex component LHP1.2011 · DOI: 10.1371/journal.pone.0016592 The hnRNP-Q protein LIF2 participates in the plant immune response.2014 · DOI: 10.1371/journal.pone.0099343 The Arabidopsis hnRNP-Q Protein LIF2 and the PRC1 Subunit LHP1 Function in Concert to Regulate the Transcription of Stress-Responsive Genes.2016 · DOI: 10.1105/tpc.16.00244

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039661 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006412 translation Biological Process

GO:0006415 translational termination Biological Process

GO:0006449 regulation of translational termination Biological Process

GO:0006479 protein methylation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT4G00830

hsa:23708

mmu:14852

mmu:14853

pon:100174020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788

Rank 1 · TkA02G129680 · TK1151

Cytoplasm0.307

Rank 2 · TkA02G129680 · TK1151

Mitochondrion0.035

Rank 3 · TkA02G129680 · TK1151

Cell membrane0.031

Rank 4 · TkA02G129680 · TK1151

Endoplasmic reticulum0.026

Rank 5 · TkA02G129680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03143GTP_EFTU_D344-109 aa

PF22594GTP-eEF1A_C45-109 aa

PF13325MCRS_N52-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G129680	`PF03143`	GTP_EFTU_D3	44	109	2e-09	38.4
TkA02G129680	`PF22594`	GTP-eEF1A_C	45	109	8.9e-17	62.1
TkA02G129680	`PF13325`	MCRS_N	52	96	0.33	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASP6`	Arabidopsis thaliana	sp\|Q9ASP6\|HNRPQ_ARATH Heterogeneous nuclear ribonucleoprotein Q	53.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card