Gene Card
Gene overview
cDNA / CDS / Protein Sequences
420 bp · TkA02G129430|TK1151|cDNA
ATGTGGAAGGACCTTTTTTGGAAAGATTTTTATACTATTAAGTTCTATCGGGTTCTAAAAAAGAAGAAGAAACTGGTTGTTCACTCTTTGGGGGTATTTCAGTCTTTTTGGCAGGAATGGAATTTTTCTGCTCATGGTAATTGGTTTTGGACCAAAAATGTCAAAATCTTTTGTTACCGGGTCCAAAAGTGTAATTTTCAAGGTATGCTGCTGCTGTTTTTTTGGGCTGTTAGTTTGTCGCTGCAAAAGTTGTTTGGCAT...
420 bp · TkA02G129430|TK1151|CDS
ATGTGGAAGGACCTTTTTTGGAAAGATTTTTATACTATTAAGTTCTATCGGGTTCTAAAAAAGAAGAAGAAACTGGTTGTTCACTCTTTGGGGGTATTTCAGTCTTTTTGGCAGGAATGGAATTTTTCTGCTCATGGTAATTGGTTTTGGACCAAAAATGTCAAAATCTTTTGTTACCGGGTCCAAAAGTGTAATTTTCAAGGTATGCTGCTGCTGTTTTTTTGGGCTGTTAGTTTGTCGCTGCAAAAGTTGTTTGGCAT...
Protein
Download Protein FASTA139 aa · TkA02G129430|TK1151|PROTEIN
MWKDLFWKDFYTIKFYRVLKKKKKLVVHSLGVFQSFWQEWNFSAHGNWFWTKNVKIFCYRVQKCNFQGMLLLFFWAVSLSLQKLFGILLMVVVKFVKFLQTRGHFWHTFDVWQPGVCIEFWHLKASRVINCILHVVCIN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G129430 |
|---|---|
| TK1151 ID | TkA02G129430 |
| OH-1004 ID | LXL04_016070 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 93.400 |
| Protein coverage (%) | TK1151 65.468 / OH-1004 22.469Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G129430 |
|---|---|
| Location | Chr02:33523655-33524074 (-) |
| Description | Similar to AAE13: Malonate--CoA ligase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006631 fatty acid metabolic process Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0035338 long-chain fatty-acyl-CoA biosynthetic process Biological Process GO:0090410 malonate catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0005524 ATP binding Molecular Function GO:0016405 CoA-ligase activity Molecular Function GO:0031956 medium-chain fatty acid-CoA ligase activity Molecular Function |
| KEGG gene cross-reference | ath:AT3G16170 bta:509209 hsa:197322 xla:444743 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.