TkA02G126240 | RubberDandelionOmics

Gene overview

TkA02G126240

Reference: TK1151 Chr: Chr02 Coordinates: 32712080-32713110 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

941 bp · TkA02G126240|TK1151|cDNA

ACTGTAAACAGTGAAACTTTGTCTTCTTTTAATAGTGAACATTCCACACATTCCCTCATAACTCAAACTTAATTTCACTCCAAGTTTCTCCGATCATGGCGTCTCAGAACTCCCTCTGGCTTTTATCGGCGTTGTTCATCGCTTTCATATGTTCTTCACACGCGATCATCTTGGAAGTTGGCGAGGATGATGGCTGGACCTTAAACCCTGTTGAAAGCTACAGTGCATGGGCTGGAAGATTGAGGTTTCGGGTGAATGAT...

CDS

Download CDS FASTA

663 bp · TkA02G126240|TK1151|CDS

ATGGCGTCTCAGAACTCCCTCTGGCTTTTATCGGCGTTGTTCATCGCTTTCATATGTTCTTCACACGCGATCATCTTGGAAGTTGGCGAGGATGATGGCTGGACCTTAAACCCTGTTGAAAGCTACAGTGCATGGGCTGGAAGATTGAGGTTTCGGGTGAATGATACCCTCCATTTCAAGTATAATGATGCGACGGATTCTGTTTTGGTGGTGAACAAAGAGGATTATGATAACTGTAACGTTGATAATCCGATTCAGAG...

Protein

Download Protein FASTA

220 aa · TkA02G126240|TK1151|PROTEIN

MASQNSLWLLSALFIAFICSSHAIILEVGEDDGWTLNPVESYSAWAGRLRFRVNDTLHFKYNDATDSVLVVNKEDYDNCNVDNPIQRLDGGDNSFRLTEGGAHYFITGNKSNCEQGQKVDVEVLHIRAQSPPSPPPAPAPLPPAPASPVAGPPPSTTPLLTPPSSAPTGGSSPSPVGSTPADLNTPPPSPVPSATPSSATAVVSGTITAAIVIIAMSSII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G126240`
TK1151 ID	TkA02G126240
OH-1004 ID	LXL04_016546
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G126240

Location Chr02:32712080-32713110 (+)

Description Similar to At4g27520: Early nodulin-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27520`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At5g25090`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At1g48940`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At3g18590`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At5g57920`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016546 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0032578 aleurone grain membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT4G27520

ath:AT4G28365

ath:AT4G32490

ath:AT5G53870

dosa:Os01g0748150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.760

Rank 1 · TkA02G126240 · TK1151

Endoplasmic reticulum0.109

Rank 2 · TkA02G126240 · TK1151

Extracellular0.079

Rank 3 · TkA02G126240 · TK1151

Cytoplasm0.066

Rank 4 · TkA02G126240 · TK1151

Nucleus0.037

Rank 5 · TkA02G126240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298Cu_bind_like34-117 aa

PF27998ArabinogalactanP127-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G126240	`PF02298`	Cu_bind_like	34	117	1.1e-22	80.6
TkA02G126240	`PF27998`	ArabinogalactanP	127	209	3.2	8.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T076`	Arabidopsis thaliana	sp\|Q9T076\|ENL02_ARATH Early nodulin-like protein 2	49.600%	Swiss-Prot	Medium
`Q8LC95`	Arabidopsis thaliana	sp\|Q8LC95\|ENL13_ARATH Early nodulin-like protein 13	40.200%	Swiss-Prot	Medium
`Q4PSZ8`	Arabidopsis thaliana	sp\|Q4PSZ8\|ENL06_ARATH Early nodulin-like protein 6	35.900%	Swiss-Prot	Medium
`Q9LII0`	Arabidopsis thaliana	sp\|Q9LII0\|ENL05_ARATH Early nodulin-like protein 5	37.200%	Swiss-Prot	Medium
`Q8L6Z5`	Arabidopsis thaliana	sp\|Q8L6Z5\|ENL10_ARATH Early nodulin-like protein 10	37.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card