RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G117820
Reference: TK1151 Chr: Chr02 Coordinates: 30734233-30735719 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

717 bp · TkA02G117820|TK1151|cDNA

TTTTCCCCAAAATCTAACACAAAACAATCTGAGATTTCAATCAGTTATCTTCTCTCAAACATAGTTTCCGTTTGATTCACTTGAAATTTGGCTCAAGTTCAAGGCTATAACACCCAAGCTCTCCGTATTCAACTGGTAACGGAGAGAGACAGTAATCCAATGAGTTCTCGGAATCAAAACAAGCCGCCTGTTCCTCGCAGTCCTGTAAATAAAAATAAAGCAGTTGATGATGCTCCTTTAGATAAACGTAGAAAAATTGG...

CDS

Download CDS FASTA

558 bp · TkA02G117820|TK1151|CDS

ATGAGTTCTCGGAATCAAAACAAGCCGCCTGTTCCTCGCAGTCCTGTAAATAAAAATAAAGCAGTTGATGATGCTCCTTTAGATAAACGTAGAAAAATTGGAGCTGGTAGGATGATGGCCTCCACAACAGCAAGTAGAGGCAGGCAAGCACTTGCCCCAATGAACAATCAGAAGGATGTTCCTGTAGCACCACCCTATGAAACCGAGGTTTCTGAGTGTGAAAATATCGAATTCACAAAGGAGGAGGTCGATGTGTTACT...

Protein

Download Protein FASTA

186 aa · TkA02G117820|TK1151|PROTEIN

MSSRNQNKPPVPRSPVNKNKAVDDAPLDKRRKIGAGRMMASTTASRGRQALAPMNNQKDVPVAPPYETEVSECENIEFTKEEVDVLLNEKFKGKKFDSKGKQDWMIEYIKKLKICIKWFQKGLEDLAEEKNKLHTMLDLSEKKFVEAEAAMKLKEEEFKSTISKLEDNISSLKQSLANEESQKLVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G117820
TK1151 IDTkA02G117820
OH-1004 IDLXL04_039894
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.900
Protein coverage (%)TK1151 98.925 / OH-1004 42.691
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G117820
LocationChr02:30734233-30735719 (+)
DescriptionSimilar to KIN14C: Kinesin-like protein KIN-14C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g21270 Kinesin that supports microtubule movement in an ATP- dependent manner and has a minus-end directed polarity.
The Arabidopsis ATK1 gene is required for spindle morphogenesis in male meiosis.2002 · DOI: 10.1242/dev.129.10.2401
Arabidopsis thaliana protein, ATK1, is a minus-end directed kinesin that exhibits non-processive movement.2002 · DOI: 10.1002/cm.10045
At4g05190 Kinesin that supports microtubule movement in an ATP- dependent manner and that functions as a minus-end directed motor as well as a plus-end tracking protein.
A minus-end-directed kinesin with plus-end tracking protein activity is involved in spindle morphogenesis.2005 · DOI: 10.1091/mbc.e04-10-0935
The kinesin ATK5 functions in early spindle assembly in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047613
At5g54670 Kinesin-like protein KIN-14N. No verified direct reference in this release
At4g27180 Kinesin-like protein KIN-14M. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0105700 Kinesin-like protein KIN-14N. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_039894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000226 microtubule cytoskeleton organization Biological Process
GO:0006412 translation Biological Process
GO:0007018 microtubule-based movement Biological Process
GO:0009971 anastral spindle assembly involved in male meiosis Biological Process
GO:0051225 spindle assembly Biological Process
GO:0051301 cell division Biological Process
GO:0000776 kinetochore Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005819 spindle Cellular Component
GO:0005871 kinesin complex Cellular Component
KEGG gene cross-reference
ath:AT4G05190
ath:AT4G21270
ath:AT4G27180
ath:AT5G54670
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.860
Rank 1 · TkA02G117820 · TK1151
Cytoplasm0.222
Rank 2 · TkA02G117820 · TK1151
Cell membrane0.028
Rank 3 · TkA02G117820 · TK1151
Mitochondrion0.026
Rank 4 · TkA02G117820 · TK1151
Endoplasmic reticulum0.016
Rank 5 · TkA02G117820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03487IL1368-118 aa
PF04242DUF42472-98 aa
PF06160EzrA88-177 aa
PF05791Bacillus_HBL97-178 aa
PF15619Lebercilin110-182 aa
PF27944CEP162_coil_mid113-133 aa
PF23888DUF7240117-169 aa
PF04242DUF424139-174 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G117820PF03487IL13681180.09913.2
TkA02G117820PF04242DUF42472980.4311.6
TkA02G117820PF06160EzrA881770.1111.5
TkA02G117820PF05791Bacillus_HBL971780.1412.7
TkA02G117820PF15619Lebercilin1101820.04813.9
TkA02G117820PF27944CEP162_coil_mid1131330.3211.7
TkA02G117820PF23888DUF72401171690.004618.0
TkA02G117820PF04242DUF4241391740.4311.6
TkA02G117820PF27944CEP162_coil_mid1451750.3211.7
TkA02G117820PF19191HEF_HK1571850.213.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q07970Arabidopsis thalianasp|Q07970|KN14C_ARATH Kinesin-like protein KIN-14C41.400%Swiss-ProtMedium
F4JGP4Arabidopsis thalianasp|F4JGP4|KN14D_ARATH Kinesin-like protein KIN-14D40.100%Swiss-ProtMedium
P46875Arabidopsis thalianasp|P46875|KN14N_ARATH Kinesin-like protein KIN-14N41.300%Swiss-ProtMedium
P46864Arabidopsis thalianasp|P46864|KN14M_ARATH Kinesin-like protein KIN-14M38.200%Swiss-ProtMedium
A3BFT0Oryza sativa subsp. japonicasp|A3BFT0|KN14N_ORYSJ Kinesin-like protein KIN-14N43.200%Swiss-ProtMedium

JBrowse

View in Genome Browser