RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G115020
Reference: TK1151 Chr: Chr02 Coordinates: 30052990-30053304 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

315 bp · TkA02G115020|TK1151|cDNA

ACAAGACTAGACCTGGCAATTCGTGTCATCGTGTCGTGTATTCGTGTCAGACACGAATTTACACGACACAAATTTGGCAAACACGAACACGACACGAATTTCAATTCGTGTCTGAGGTATCAAACACGAACACGACACGGGCCAAGCACGAACACGACACGAACACGACACGAATTTCAATTCGTGTCGTGTTTTCAGACACGAACACGACACGAAACAAAAAAACAAGAAACAAATGAACAAAATTCAGTAATCGGGAA...

CDS

Download CDS FASTA

315 bp · TkA02G115020|TK1151|CDS

ACAAGACTAGACCTGGCAATTCGTGTCATCGTGTCGTGTATTCGTGTCAGACACGAATTTACACGACACAAATTTGGCAAACACGAACACGACACGAATTTCAATTCGTGTCTGAGGTATCAAACACGAACACGACACGGGCCAAGCACGAACACGACACGAACACGACACGAATTTCAATTCGTGTCGTGTTTTCAGACACGAACACGACACGAAACAAAAAAACAAGAAACAAATGAACAAAATTCAGTAATCGGGAA...

Protein

Download Protein FASTA

104 aa · TkA02G115020|TK1151|PROTEIN

TRLDLAIRVIVSCIRVRHEFTRHKFGKHEHDTNFNSCLRYQTRTRHGPSTNTTRTRHEFQFVSCFQTRTRHETKKQETNEQNSVIGNIKNIQQSGTLRTFSNRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G115020
TK1151 IDTkA02G115020
OH-1004 IDLXL04_006765
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)85.100
Protein coverage (%)TK1151 97.115 / OH-1004 10.619
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G115020
LocationChr02:30052990-30053304 (+)
DescriptionSimilar to At4g37250: Probable LRR receptor-like serine/threonine-protein kinase At4g37250
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006765 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010030 positive regulation of seed germination Biological Process
GO:0010069 zygote asymmetric cytokinesis in embryo sac Biological Process
GO:0010070 zygote asymmetric cell division Biological Process
GO:0042631 cellular response to water deprivation Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G48480
ath:AT1G66830
ath:AT2G01210
ath:AT4G34220
ath:AT4G37250
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.563
Rank 1 · TkA02G115020 · TK1151
Cytoplasm0.397
Rank 2 · TkA02G115020 · TK1151
Mitochondrion0.066
Rank 3 · TkA02G115020 · TK1151
Extracellular0.050
Rank 4 · TkA02G115020 · TK1151
Cell membrane0.035
Rank 5 · TkA02G115020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser