TkA02G113110 | RubberDandelionOmics

Gene overview

TkA02G113110

Reference: TK1151 Chr: Chr02 Coordinates: 29617741-29620512 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

782 bp · TkA02G113110|TK1151|cDNA

TTTAATTTCTTTATACGACTATCAAGGGACAACTCACATCATCTTTCTTTATTTCATTGCAAATAGAACAACAAAATCATGCGTTTCTGCTGCCTCTTCACTTAAAATTCCGGAATGTTCTTCTTAGCTTTGATTCAAGTCTGAAGGAATTCTCTGCGGCGCTCTCTGATCTGGGTTTTTCTCTATCTTAGGGGTTTAACTTCGATTTTACTCGACAGGGTAGATGGCGACGCTAGCAGATATCGGTCTGTCGGCAGCCA...

CDS

Download CDS FASTA

366 bp · TkA02G113110|TK1151|CDS

ATGGCGACGCTAGCAGATATCGGTCTGTCGGCAGCCATTAATATCATCACTGCTTTTATTTTCCTGATAGCTTTCGCTATCCTTCGACTTCAACCTTTCAACGATCGTGTATACTTTCCAAAATGGTATCTCAAGGGTTTACGATCAAGCCCTGCAACTTCCGGTGCTTTTGTAAGCAAGTTCATCAATCTGGATTATCGATCCTATTTAAAATTCCTTAATTGGATGCCGGATGCCTTAAAAATGCCCGAGCCTGAGCT...

Protein

Download Protein FASTA

121 aa · TkA02G113110|TK1151|PROTEIN

MATLADIGLSAAINIITAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRSSPATSGAFVSKFINLDYRSYLKFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLLGAKVGVREGEREFTRET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G113110`
TK1151 ID	TkA02G113110
OH-1004 ID	LXL04_009987
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 89.256 / OH-1004 6.498 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G113110

Location Chr02:29617741-29620512 (-)

Description Similar to EMB2369: Leucine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62320`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At3g21620`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g11960`	Calcium-permeable channel that plays a key role in plant stomatal immunity.	The calcium-permeable channel OSCA1.3 regulates plant stomatal immunity.2020 · DOI: 10.1038/s41586-020-2702-1
`At4g22120`	Acts as an osmosensitive calcium-permeable cation channel.	OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844 Structure-guided mutagenesis of OSCAs reveals differential activation to mechanical stimuli.2024 · DOI: 10.7554/elife.93147
`At4g15430`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009987 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006429 leucyl-tRNA aminoacylation Biological Process

GO:0006812 monoatomic cation transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0071474 cellular hyperosmotic response Biological Process

GO:0090279 regulation of calcium ion import Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT3G21620

ath:AT4G04340

ath:AT4G04350

ath:AT4G22120

sru:SRU_0933

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.429

Rank 1 · TkA02G113110 · TK1151

Golgi apparatus0.239

Rank 2 · TkA02G113110 · TK1151

Cell membrane0.133

Rank 3 · TkA02G113110 · TK1151

Lysosome / Vacuole0.099

Rank 4 · TkA02G113110 · TK1151

Cytoplasm0.093

Rank 5 · TkA02G113110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13967RSN1_TM8-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G113110	`PF13967`	RSN1_TM	8	107	1.1e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HYR3`	Arabidopsis thaliana	sp\|F4HYR3\|OSC14_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.4	83.300%	Swiss-Prot	High
`Q9LVE4`	Arabidopsis thaliana	sp\|Q9LVE4\|OSC15_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.5	79.600%	Swiss-Prot	High
`B5TYT3`	Arabidopsis thaliana	sp\|B5TYT3\|OSC13_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.3	80.000%	Swiss-Prot	High
`Q5XEZ5`	Arabidopsis thaliana	sp\|Q5XEZ5\|OSC12_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.2	78.700%	Swiss-Prot	High
`Q8VZM5`	Arabidopsis thaliana	sp\|Q8VZM5\|OSC16_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.6	77.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card