TkA02G110650 | RubberDandelionOmics

Gene overview

TkA02G110650

Reference: TK1151 Chr: Chr02 Coordinates: 28981843-28985140 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · TkA02G110650|TK1151|cDNA

ATGAGACATCCAAAACTAAGCCTCTCCCCCGGATTCAGCTCCTTCTCCTTGATCAGCTCAAGAGCATCTCCATTTCCTCGATCAGCTCAAGAGCATCTGCAGTATGCACGCTTGCACGCGTTCATAGTTTCCCTAAACGCATGCTTCAAATTCCTCCGTCCCAGTCTCTCTCGAAAAACGAAGACGACTACTCATCTCTGTGGCTATCGCACTGCTTATAAAACACCACCCAAACACCGTCGTTTTCATCTCCATCACAC...

CDS

Download CDS FASTA

1236 bp · TkA02G110650|TK1151|CDS

ATGAGACATCCAAAACTAAGCCTCTCCCCCGGATTCAGCTCCTTCTCCTTGATCAGCTCAAGAGCATCTCCATTTCCTCGATCAGCTCAAGAGCATCTGCAGTATGCACGCTTGCACGCGTTCATAGTTTCCCTAAACGCATGCTTCAAATTCCTCCGTCCCAGTCTCTCTCGAAAAACGAAGACGACTACTCATCTCTGTGGCTATCGCACTGCTTATAAAACACCACCCAAACACCGTCGTTTTCATCTCCATCACAC...

Protein

Download Protein FASTA

411 aa · TkA02G110650|TK1151|PROTEIN

MRHPKLSLSPGFSSFSLISSRASPFPRSAQEHLQYARLHAFIVSLNACFKFLRPSLSRKTKTTTHLCGYRTAYKTPPKHRRFHLHHTNDSERRFRDAAVVDDGDVVLEQRLKDVEAERDRKAVNSPGFSFSAAGLLFPHHLGVAKFLIEKGYIKLMLDLEIHIEDISSCIQLFYFKLYTGRGRGLSFYTTEKALSDVFSQFGQVVEATVMMDKVSSRSKGFGFITFASELEAEKAINEMDRKERDVERVRQRDELLAKAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G110650`
TK1151 ID	TkA02G110650
OH-1004 ID	LXL04_034120
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 32.847 / OH-1004 11.893 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G110650

Location Chr02:28981843-28985140 (-)

Description Similar to SMC5: Structural maintenance of chromosomes protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15920`	Core component of the SMC5-SMC6 complex that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids.	The STRUCTURAL MAINTENANCE OF CHROMOSOMES 5/6 complex promotes sister chromatid alignment and homologous recombination after DNA damage in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.108.060525
`At5g06210`	Probable RNA-binding protein that may be involved in salt and oxidative stress tolerance.	The Arabidopsis chloroplast protein S-RBP11 is involved in oxidative and salt stress responses.2014 · DOI: 10.1007/s00299-013-1560-9
`At3g23830`	Possibly has a role in RNA transcription or processing during stress.	Characterization of transgenic Arabidopsis plants overexpressing GR-RBP4 under high salinity, dehydration, or cold stress.2005 · DOI: 10.1093/jxb/eri298
`At4g13850`	Promotes the cis-splicing and editing of several mitochondrial RNAs (including NAD5 transcripts).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034120 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0018393 internal peptidyl-lysine acetylation Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0030261 chromosome condensation Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0034184 positive regulation of maintenance of mitotic sister chromatid cohesion Biological Process

GO:0044772 mitotic cell cycle phase transition Biological Process

KEGG gene cross-reference

ath:AT5G15920

dre:566749

hsa:23137

mmu:226026

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.301

Rank 1 · TkA02G110650 · TK1151

Plastid0.241

Rank 2 · TkA02G110650 · TK1151

Nucleus0.238

Rank 3 · TkA02G110650 · TK1151

Cytoplasm0.171

Rank 4 · TkA02G110650 · TK1151

Cell membrane0.052

Rank 5 · TkA02G110650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24835DUF771772-96 aa

PF00076RRM_1184-244 aa

PF28976RRM_ACIN1190-240 aa

PF05172RRM_Nup35197-238 aa

PF14605Nup35_RRM_2198-235 aa

PF14362DUF4407225-340 aa

PF06785UPF0242233-312 aa

PF02413Caudo_TAP273-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G110650	`PF24835`	DUF7717	72	96	0.4	11.7
TkA02G110650	`PF00076`	RRM_1	184	244	8.3e-17	61.5
TkA02G110650	`PF28976`	RRM_ACIN1	190	240	0.14	13.0
TkA02G110650	`PF05172`	RRM_Nup35	197	238	0.1	13.3
TkA02G110650	`PF14605`	Nup35_RRM_2	198	235	0.27	11.9
TkA02G110650	`PF14362`	DUF4407	225	340	3.3	7.6
TkA02G110650	`PF06785`	UPF0242	233	312	0.16	12.7
TkA02G110650	`PF02413`	Caudo_TAP	273	338	2.4	9.0
TkA02G110650	`PF24835`	DUF7717	276	347	0.4	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFS8`	Arabidopsis thaliana	sp\|Q9LFS8\|SMC5_ARATH Structural maintenance of chromosomes protein 5	45.700%	Swiss-Prot	Low
`Q9FFZ6`	Arabidopsis thaliana	sp\|Q9FFZ6\|RBP11_ARATH Small RNA-binding protein 11, chloroplastic	61.500%	Swiss-Prot	Low
`Q9LIS2`	Arabidopsis thaliana	sp\|Q9LIS2\|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial	48.500%	Swiss-Prot	Low
`Q9SVM8`	Arabidopsis thaliana	sp\|Q9SVM8\|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial	42.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card