TkA02G099210 | RubberDandelionOmics

Gene overview

TkA02G099210

Reference: TK1151 Chr: Chr02 Coordinates: 25881151-25882976 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1087 bp · TkA02G099210|TK1151|cDNA

TCCTTTCTCTTCTCCATCGCGCCGAAGCCAGCTGTTCGTCGATCTGTGGTGTGCAAACCGACCTCCTATGGTTGTTTATTCCGGCAACGAAGGTGCTGTTCGTCGAAGGCAGTCGGCGTTCCAGCGAGGAAGAGGGACAAGATGAAGACTATCTTATCATCTGAGACCATGGACATACCTGACGGTGTGGAGATCAAGGTCCATGCCAAGATCATTGAAGTGACCGGACCACGAGGAACCCTTAATCGCAATTTCAACCA...

CDS

Download CDS FASTA

636 bp · TkA02G099210|TK1151|CDS

TCCTTTCTCTTCTCCATCGCGCCGAAGCCAGCTGTTCGTCGATCTGTGGTGTGCAAACCGACCTCCTATGGTTGTTTATTCCGGCAACGAAGGTGCTGTTCGTCGAAGGCAGTCGGCGTTCCAGCGAGGAAGAGGGACAAGATGAAGACTATCTTATCATCTGAGACCATGGACATACCTGACGGTGTGGAGATCAAGGTCCATGCCAAGATCATTGAAGTGACCGGACCACGAGGAACCCTTAATCGCAATTTCAACCA...

Protein

Download Protein FASTA

211 aa · TkA02G099210|TK1151|PROTEIN

SFLFSIAPKPAVRRSVVCKPTSYGCLFRQRRCCSSKAVGVPARKRDKMKTILSSETMDIPDGVEIKVHAKIIEVTGPRGTLNRNFNHLNLDFLLITDEETGKRKLKVDAWFGSRKTTASIRTALSHVNNLITGVAQGFRYKMRFVYAHFPINASISNNNSTIEIRNFLGEKKVDMLNGVTVVRSEKVKDELVLDGNDIELVSRSCALINQV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G099210`
TK1151 ID	TkA02G099210
OH-1004 ID	LXL04_007649
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.600
Protein coverage (%)	TK1151 96.209 / OH-1004 76.580 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G099210

Location Chr02:25881151-25882976 (-)

Description Similar to RPL9B: 60S ribosomal protein L9-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P49209`	Large ribosomal subunit protein uL6z/uL6y.	No verified direct reference in this release
`At4g10450`	Large ribosomal subunit protein uL6x.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0485900`	Large ribosomal subunit protein uL6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007649 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0006941 striated muscle contraction Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G33120

ath:AT1G33140

ath:AT4G10450

dosa:Os09g0485900

mmu:20005

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.870

Rank 1 · TkA02G099210 · TK1151

Plastid0.071

Rank 2 · TkA02G099210 · TK1151

Cytoplasm0.068

Rank 3 · TkA02G099210 · TK1151

Nucleus0.043

Rank 4 · TkA02G099210 · TK1151

Cell membrane0.013

Rank 5 · TkA02G099210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00347Ribosomal_L659-137 aa

PF00347Ribosomal_L6149-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G099210	`PF00347`	Ribosomal_L6	59	137	4.1e-16	60.2
TkA02G099210	`PF00347`	Ribosomal_L6	149	211	4.1e-16	60.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49209`	Arabidopsis thaliana	sp\|P49209\|RL91_ARATH Large ribosomal subunit protein uL6z/uL6y	80.100%	Swiss-Prot	High
`Q9SZX9`	Arabidopsis thaliana	sp\|Q9SZX9\|RL92_ARATH Large ribosomal subunit protein uL6x	78.900%	Swiss-Prot	High
`P49210`	Oryza sativa subsp. japonica	sp\|P49210\|RL9_ORYSJ Large ribosomal subunit protein uL6	74.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card