TkA02G094580 | RubberDandelionOmics

Gene overview

TkA02G094580

Reference: TK1151 Chr: Chr02 Coordinates: 24691638-24693130 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

978 bp · TkA02G094580|TK1151|cDNA

CACTAACAAACCAAGTGCACTCATAAAAAATCATGCACTATTCCACTAAAATCGTCCTCATATTTACCCTTTTATCATGGGCAAACTTGTCAATTTCCATGAACATCACAATCATCAACAATTGCCACGAAACCATCTGGCCCGGCATAACCGCCACCAACACCACCCTTCCTGGTGGCGGTTTCGTCTTAAAACCAGGCGAAACCGCCATCTACACCACCCCACCAGTATGGGGCAGTCGTATATGGGGCAGAACCGGA...

CDS

Download CDS FASTA

849 bp · TkA02G094580|TK1151|CDS

ATGCACTATTCCACTAAAATCGTCCTCATATTTACCCTTTTATCATGGGCAAACTTGTCAATTTCCATGAACATCACAATCATCAACAATTGCCACGAAACCATCTGGCCCGGCATAACCGCCACCAACACCACCCTTCCTGGTGGCGGTTTCGTCTTAAAACCAGGCGAAACCGCCATCTACACCACCCCACCAGTATGGGGCAGTCGTATATGGGGCAGAACCGGATGCAGTTTCGACAAAAACAACAACGGTACATG...

Protein

Download Protein FASTA

282 aa · TkA02G094580|TK1151|PROTEIN

MHYSTKIVLIFTLLSWANLSISMNITIINNCHETIWPGITATNTTLPGGGFVLKPGETAIYTTPPVWGSRIWGRTGCSFDKNNNGTCQTGSCGTSLICTTPGTPPASIAEFTLSDTAFYDVSLVDGFNLPITVTPIQGKGECSIAGCDTDLRVSCPPELTFRSDGKVVACRSACNVFDSDEYCCKGMYGNPVTCVPTNYSKIFKTACPVAYSYAYDDPTSIITCSTTDFVVSFCSPRNQTQQCSYHDNKLVCNGSTRSKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G094580`
TK1151 ID	TkA02G094580
OH-1004 ID	LXL04_016895
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G094580

Location Chr02:24691638-24693130 (+)

Description Similar to Pathogenesis-related thaumatin-like protein 3.5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18250`	Thaumatin-like protein.	No verified direct reference in this release
`At1g75040`	Partially responsible for acquired pathogen resistance.	No verified direct reference in this release
`At4g24180`	Involved in local responses of roots to colonization by non-pathogenic plant growth-promoting rhizobacteria (PGPR) fluorescent Pseudomonas spp., but does not seem to be required for the establishment of subsequent induced systemic resistance (ISR).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0706600`	Thaumatin-like protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016895 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009615 response to virus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010224 response to UV-B Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G18250

ath:AT1G75040

ath:AT4G24180

dosa:Os11g0706600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.590

Rank 1 · TkA02G094580 · TK1151

Cytoplasm0.122

Rank 2 · TkA02G094580 · TK1151

Extracellular0.118

Rank 3 · TkA02G094580 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA02G094580 · TK1151

Lysosome / Vacuole0.107

Rank 5 · TkA02G094580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314Thaumatin29-235 aa

PF16483Glyco_hydro_6454-140 aa

PF16483Glyco_hydro_64198-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G094580	`PF00314`	Thaumatin	29	235	1.1e-73	248.1
TkA02G094580	`PF16483`	Glyco_hydro_64	54	140	0.003	17.6
TkA02G094580	`PF16483`	Glyco_hydro_64	198	218	0.003	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P50699`	Arabidopsis thaliana	sp\|P50699\|TLPH_ARATH Thaumatin-like protein	54.200%	Swiss-Prot	High
`P28493`	Arabidopsis thaliana	sp\|P28493\|PR5_ARATH Pathogenesis-related protein 5	49.300%	Swiss-Prot	Medium
`A0A1P8B554`	Arabidopsis thaliana	sp\|A0A1P8B554\|THLP1_ARATH Thaumatin-like protein 1	47.300%	Swiss-Prot	Medium
`Q53MB8`	Oryza sativa subsp. japonica	sp\|Q53MB8\|TLPH_ORYSJ Thaumatin-like protein	45.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card