TkA02G091960 | RubberDandelionOmics

Gene overview

TkA02G091960

Reference: TK1151 Chr: Chr02 Coordinates: 23965008-23967857 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

958 bp · TkA02G091960|TK1151|cDNA

CACATCTTGGATGTCTACAAAGGTTCCATGAGTCAAATTGTTAAAAAGTACAAACATGATAAATTAAAATTGCATGGAACTGGAAAAAATGTACCCAAGGGGGAAGCATCGCGTGTGCTTCGTCATCTTGTTGTTGAGGAGATTCTTGTGGAAGATGTAAAGAAAAGTGATCTTTATGGATCTGTATCTTCGGTTTTAAAGGTAAATGAAAAGAAGGCTGGCAGTTTAATGGCAGGCCAACAAATCATAACCTTAAGATT...

CDS

Download CDS FASTA

900 bp · TkA02G091960|TK1151|CDS

ATGAGTCAAATTGTTAAAAAGTACAAACATGATAAATTAAAATTGCATGGAACTGGAAAAAATGTACCCAAGGGGGAAGCATCGCGTGTGCTTCGTCATCTTGTTGTTGAGGAGATTCTTGTGGAAGATGTAAAGAAAAGTGATCTTTATGGATCTGTATCTTCGGTTTTAAAGGTAAATGAAAAGAAGGCTGGCAGTTTAATGGCAGGCCAACAAATCATAACCTTAAGATTTCCTTCTGGTTTAAAACCTTTAAAGAC...

Protein

Download Protein FASTA

299 aa · TkA02G091960|TK1151|PROTEIN

MSQIVKKYKHDKLKLHGTGKNVPKGEASRVLRHLVVEEILVEDVKKSDLYGSVSSVLKVNEKKAGSLMAGQQIITLRFPSGLKPLKTSSRKYSTSSIQNSVQVDTPSPPQPPPQPQVDKELSNKLFEALRLLRTVLIKEGSQRGMSFSAHHIFGNETLHNICERIPRTKDELLEVNGIGNVKATKYGDRLLETIEETINNHYNDSNKTKSNSSDSIKRRRRSTSQIPNGAPIDNDEDDFVASTARTKKRVVEKPDPVVEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G091960`
TK1151 ID	TkA02G091960
OH-1004 ID	LXL04_016927
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 24.711 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G091960

Location Chr02:23965008-23967857 (+)

Description Similar to RECQL4A: ATP-dependent DNA helicase Q-like 4A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10930`	DNA helicase involved in DNA repair.	Arabidopsis RecQI4A suppresses homologous recombination and modulates DNA damage responses.2005 · DOI: 10.1111/j.1365-313x.2005.02501.x Two closely related RecQ helicases have antagonistic roles in homologous recombination and DNA repair in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705998104 Topoisomerase 3alpha and RMI1 suppress somatic crossovers and are essential for resolution of meiotic recombination intermediates in Arabidopsis thaliana.2008 · DOI: 10.1371/journal.pgen.1000285 The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2010.04438.x
`At1g60930`	3'-5' DNA helicase that may play a role in the repair of DNA (By similarity).	Two closely related RecQ helicases have antagonistic roles in homologous recombination and DNA repair in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705998104

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016927 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000725 recombinational repair Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006301 DNA damage tolerance Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0010165 response to X-ray Biological Process

KEGG gene cross-reference

ath:AT1G10930

ath:AT1G60930

mmu:12144

spo:2541620

xla:373628

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · TkA02G091960 · TK1151

Cytoplasm0.179

Rank 2 · TkA02G091960 · TK1151

Mitochondrion0.026

Rank 3 · TkA02G091960 · TK1151

Cell membrane0.016

Rank 4 · TkA02G091960 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA02G091960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09382RQC3-80 aa

PF15912VIR_N97-120 aa

PF00570HRDC124-194 aa

PF00633HHH165-183 aa

PF15912VIR_N201-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G091960	`PF09382`	RQC	3	80	7e-11	42.7
TkA02G091960	`PF15912`	VIR_N	97	120	0.19	11.8
TkA02G091960	`PF00570`	HRDC	124	194	4.9e-12	46.3
TkA02G091960	`PF00633`	HHH	165	183	0.067	13.8
TkA02G091960	`PF15912`	VIR_N	201	263	0.19	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L840`	Arabidopsis thaliana	sp\|Q8L840\|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A	44.300%	Swiss-Prot	Medium
`Q9FT70`	Arabidopsis thaliana	sp\|Q9FT70\|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B	46.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card