TkA02G090630 | RubberDandelionOmics

Gene overview

TkA02G090630

Reference: TK1151 Chr: Chr02 Coordinates: 23542097-23545317 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1518 bp · TkA02G090630|TK1151|cDNA

GTTTTATCAAAAAAATATTTATTGAGTTATATATTATTGCCCCCTAAAAGGCTAAAACCCTTCTTCAAAGTTCATCATGGAAAACTCTTCAAGGAATCTGGGAAAGTAAAAAATGACAGACGACGATCAATCGCAGCCGTTGGAAACTATTCACCCGCCGGTTAAACGCTCTGAATCTCCCCAACGGCCATTGAAGATCGCCAAATTATCCGACGAAGACGACGAACCAGAAGCGGTAGAGAATCGAACAATGGGGAAGA...

CDS

Download CDS FASTA

1101 bp · TkA02G090630|TK1151|CDS

ATGACAGACGACGATCAATCGCAGCCGTTGGAAACTATTCACCCGCCGGTTAAACGCTCTGAATCTCCCCAACGGCCATTGAAGATCGCCAAATTATCCGACGAAGACGACGAACCAGAAGCGGTAGAGAATCGAACAATGGGGAAGAACCCTAGGACGTTCCAACGGTACCTAGTCGCAGTTGAATACATCGGAACTCGCTTCTCTGGTGCTCAACAACAAACACCCAATTGCAGAACCGTCGTCGGTGTTCTCCAGAA...

Protein

Download Protein FASTA

366 aa · TkA02G090630|TK1151|PROTEIN

MTDDDQSQPLETIHPPVKRSESPQRPLKIAKLSDEDDEPEAVENRTMGKNPRTFQRYLVAVEYIGTRFSGAQQQTPNCRTVVGVLQNAFHKFVGQPVPIFCSSRTDAGVHALSNVCHVDVERISKRKPGEVLPPHEPSVVKKAVNHFLQKHEGDITIIDVRCVAPDFHARYKAQERTYFYRILSGPEHVSTFEKDRAWHVPEDLDLPTMQKACKVLVGLHDFSSFRASGCQAKSPIRNLDELNVIEVFPSPYFPSAKERE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G090630`
TK1151 ID	TkA02G090630
OH-1004 ID	LXL04_016951
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G090630`
Location	Chr02:23542097-23545317 (+)
Description	Similar to truA: tRNA pseudouridine synthase A (Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016951` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0031119 tRNA pseudouridine synthesis Biological Process GO:0003723 RNA binding Molecular Function GO:0160147 tRNA pseudouridine(38-40) synthase activity Molecular Function
KEGG gene cross-reference	mag:amb0241 pla:Plav_0263 rfe:RF_1356 rri:A1G_07265 xau:Xaut_3303 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.600

Rank 1 · TkA02G090630 · TK1151

Nucleus0.442

Rank 2 · TkA02G090630 · TK1151

Cytoplasm0.135

Rank 3 · TkA02G090630 · TK1151

Plastid0.023

Rank 4 · TkA02G090630 · TK1151

Cell membrane0.018

Rank 5 · TkA02G090630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01416PseudoU_synth_160-171 aa

PF01416PseudoU_synth_1212-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G090630	`PF01416`	PseudoU_synth_1	60	171	2.7e-35	121.8
TkA02G090630	`PF01416`	PseudoU_synth_1	212	364	2.7e-35	121.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card