RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G085700
Reference: TK1151 Chr: Chr02 Coordinates: 22278749-22279744 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

966 bp · TkA02G085700|TK1151|cDNA

ATGATCGGATCAGGCTCGTTCGGGGTTGTTCATTTGGCGGTCAACAAATCAAGCGGCTCACTTTTCGTGGTGAAGTCATCGGAATCTCAAGAGGGGGATCAGTCTCTCCAGAACGAAGCTAACGTTCTCGCGAGTCTGGATTCCCCTCACATTGTACAGTGTCTTGGTAAAGACGTTTCCTTTGGTGAAAACGGCCACCCGAAAACAAATCTTTTCATCGAGTACATGGCGGCCGGAAGTCTCGGCGATGTCGTTGAGAA...

CDS

Download CDS FASTA

966 bp · TkA02G085700|TK1151|CDS

ATGATCGGATCAGGCTCGTTCGGGGTTGTTCATTTGGCGGTCAACAAATCAAGCGGCTCACTTTTCGTGGTGAAGTCATCGGAATCTCAAGAGGGGGATCAGTCTCTCCAGAACGAAGCTAACGTTCTCGCGAGTCTGGATTCCCCTCACATTGTACAGTGTCTTGGTAAAGACGTTTCCTTTGGTGAAAACGGCCACCCGAAAACAAATCTTTTCATCGAGTACATGGCGGCCGGAAGTCTCGGCGATGTCGTTGAGAA...

Protein

Download Protein FASTA

321 aa · TkA02G085700|TK1151|PROTEIN

MIGSGSFGVVHLAVNKSSGSLFVVKSSESQEGDQSLQNEANVLASLDSPHIVQCLGKDVSFGENGHPKTNLFIEYMAAGSLGDVVEKLGGKLDEGVIRVYTREILKGLKYLHDVGIVHGDVKCQNVLLGPCGTIKLADFGCARRNHQKFLCGTPLWMAPEVLKNESLDFSADIWSLGCTIIEMATGRTPWGELGASNQMAAILKIASSNELPSFPQEFPKSGLDFLNKCLVRKAERRSTVDELLNHPFIMGETVVKKHET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G085700
TK1151 IDTkA02G085700
OH-1004 IDLXL04_016983
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)96.700
Protein coverage (%)TK1151 100.000 / OH-1004 95.389
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G085700
LocationChr02:22278749-22279744 (+)
DescriptionSimilar to MAPKKK17: Mitogen-activated protein kinase kinase kinase 17
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g32510 Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses. No verified direct reference in this release
At3g06030 Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.
Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
At1g09000 May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.
Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940
An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164
At3g50310 Mitogen-activated protein kinase kinase (MAPKK) that phosphorylates both MKK3 and MPK18 and regulate two separate signaling pathways involved in root microtubule functions.
Arabidopsis MKKK20 is involved in osmotic stress response via regulation of MPK6 activity.2012 · DOI: 10.1007/s00299-011-1157-0
AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386
The Arabidopsis Mitogen-Activated Protein Kinase Kinase Kinase 20 (MKKK20) Acts Upstream of MKK3 and MPK18 in Two Separate Signaling Pathways Involved in Root Microtubule Functions.2017 · DOI: 10.3389/fpls.2017.01352
At1g54960 Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.
Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_016983 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000302 response to reactive oxygen species Biological Process
GO:0000919 cell plate assembly Biological Process
GO:0006468 protein phosphorylation Biological Process
GO:0006952 defense response Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007165 signal transduction Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
KEGG gene cross-reference
ath:AT1G05100
ath:AT1G09000
ath:AT2G32510
ath:AT3G50310
nta:107796336
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.541
Rank 1 · TkA02G085700 · TK1151
Cytoplasm0.507
Rank 2 · TkA02G085700 · TK1151
Cell membrane0.096
Rank 3 · TkA02G085700 · TK1151
Endoplasmic reticulum0.047
Rank 4 · TkA02G085700 · TK1151
Golgi apparatus0.030
Rank 5 · TkA02G085700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-249 aa
PF07714PK_Tyr_Ser-Thr2-245 aa
PF03109ABC12-26 aa
PF01636APH21-113 aa
PF19974TCAD9101-146 aa
PF17667Pkinase_fungal103-166 aa
PF07387Seadorna_VP7105-141 aa
PF03109ABC1107-149 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G085700PF00069Pkinase22493.1e-57194.7
TkA02G085700PF07714PK_Tyr_Ser-Thr22451.2e-37130.4
TkA02G085700PF03109ABC12260.003717.2
TkA02G085700PF01636APH211130.1712.3
TkA02G085700PF19974TCAD91011460.112.5
TkA02G085700PF17667Pkinase_fungal1031660.1911.2
TkA02G085700PF07387Seadorna_VP71051410.00816.0
TkA02G085700PF03109ABC11071490.003717.2
TkA02G085700PF14531Kinase-like1081921.3e-0525.3
TkA02G085700PF01636APH1111430.1712.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O80888Arabidopsis thalianasp|O80888|M3K17_ARATH Mitogen-activated protein kinase kinase kinase 1742.300%Swiss-ProtMedium
O22042Arabidopsis thalianasp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 340.100%Swiss-ProtMedium
O22040Arabidopsis thalianasp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP139.000%Swiss-ProtMedium
Q9SND6Arabidopsis thalianasp|Q9SND6|M3K20_ARATH Mitogen-activated protein kinase kinase kinase 2040.100%Swiss-ProtMedium
Q9FZ36Arabidopsis thalianasp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 239.000%Swiss-ProtMedium

JBrowse

View in Genome Browser