TkA02G084190 | RubberDandelionOmics

Gene overview

TkA02G084190

Reference: TK1151 Chr: Chr02 Coordinates: 21846854-21851354 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2705 bp · TkA02G084190|TK1151|cDNA

TTTTGCTTTATTTTGTCAATAAATGGCACAATTAAAACAACATAAATCTCTCCCCTAAAACCCACTCACAAAACCCTGCAAAATATCCCCACCTCTTCTCTCTCCTCTCTTGCTTTTCAACAAAACTTTTGAGCTATGATCATCCGTTACTCTGACTAGTATTTTGTTTTATCACCACTGAATCGAAAACCCCCAAATCACTCATCTTCTAGCTCAACTCATACGCATTTCTCCAAATCGTTTGTTATGGGAATCATCTT...

CDS

Download CDS FASTA

2166 bp · TkA02G084190|TK1151|CDS

ATGAAAAAGAAATCGAATAAAGCTTACAACAAGGTAGATTATGCAGAAGAATGGTGCTTTCAATGCAAAGATGGTGGCGATTTAATCATTTGCGACCACAAGAATTGTTTCAAGTCGTATCATTCACATCCAGAATGCACACAACAGGGCAAGTCATCTATAAATCGTCGATTTATATGTGTTCTGCATAAATGTGATGTTTGTGGTAGAGCTTCCGATGTCCATTGTTATGGCTGTCCGAAAGGTGTATGCAGACGCTG...

Protein

Download Protein FASTA

721 aa · TkA02G084190|TK1151|PROTEIN

MKKKSNKAYNKVDYAEEWCFQCKDGGDLIICDHKNCFKSYHSHPECTQQGKSSINRRFICVLHKCDVCGRASDVHCYGCPKGVCRRCIKSTDFVHVKGKKGFCSYCLKLSLLIEENKDVDSDGETIDFNNRDTYETLYKEYWEIINAKEKLTLDDLISANGQLNTGKNYDSDKYDDSDGYQCSDYEEKGDDDDMELHEKKPKKPKPESSKTKRKGQEKLKPKSKEKEKLKSNKEEFMGWGSTRLIKFLSYIEKDTTNPLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G084190`
TK1151 ID	TkA02G084190
OH-1004 ID	LXL04_017012
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 73.786 / OH-1004 97.615 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G084190

Location Chr02:21846854-21851354 (-)

Description Similar to At5g08430: Uncharacterized protein At5g08430

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08430`	Uncharacterized protein At5g08430.	No verified direct reference in this release
`UniProt: Q9SIV5`	Plays a central role in integrating RNA silencing and chromatin signals in 21 nt siRNA-dependent DNA methylation on cytosine pathway leading to transcriptional gene silencing of specific sequences.	No verified direct reference in this release
`At3g51120`	Zinc finger CCCH domain-containing protein 44.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017012 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0032259 methylation Biological Process

GO:0070201 regulation of establishment of protein localization Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:2001032 regulation of double-strand break repair via nonhomologous end joining Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT2G16485

ath:AT5G08430

hsa:7468

mmu:107823

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA02G084190 · TK1151

Cytoplasm0.120

Rank 2 · TkA02G084190 · TK1151

Cell membrane0.020

Rank 3 · TkA02G084190 · TK1151

Mitochondrion0.012

Rank 4 · TkA02G084190 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA02G084190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22586ANCHR-like_BBOX15-42 aa

PF22586ANCHR-like_BBOX65-91 aa

PF02201SWIB256-312 aa

PF24406nSTAND_NTPase4259-284 aa

PF03126Plus-3385-482 aa

PF25980NERD_plant504-551 aa

PF02201SWIB513-551 aa

PF02201SWIB608-635 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G084190	`PF22586`	ANCHR-like_BBOX	15	42	0.028	15.2
TkA02G084190	`PF22586`	ANCHR-like_BBOX	65	91	0.028	15.2
TkA02G084190	`PF02201`	SWIB	256	312	0.00065	20.1
TkA02G084190	`PF24406`	nSTAND_NTPase4	259	284	0.077	13.9
TkA02G084190	`PF03126`	Plus-3	385	482	1.6e-14	55.0
TkA02G084190	`PF25980`	NERD_plant	504	551	3.7e-22	78.6
TkA02G084190	`PF02201`	SWIB	513	551	0.00065	20.1
TkA02G084190	`PF02201`	SWIB	608	635	0.00065	20.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT92`	Arabidopsis thaliana	sp\|Q9FT92\|Y5843_ARATH Uncharacterized protein At5g08430	41.700%	Swiss-Prot	Low
`Q9SIV5`	Arabidopsis thaliana	sp\|Q9SIV5\|C3H19_ARATH Zinc finger CCCH domain-containing protein 19	28.200%	Swiss-Prot	Low
`Q9SD34`	Arabidopsis thaliana	sp\|Q9SD34\|C3H44_ARATH Zinc finger CCCH domain-containing protein 44	24.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card