TkA02G084010 | RubberDandelionOmics

Gene overview

TkA02G084010

Reference: TK1151 Chr: Chr02 Coordinates: 21796360-21799215 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1810 bp · TkA02G084010|TK1151|cDNA

GATGGATGGTACTATGACGTTGAAAGAAGTTTATACTGGGAGGACTTAAGTGTAAATTGTCTGGTATATATACGGAGACAGTGAGTGGTTTCATTCTTCACCGCCGTCACCGTCTATAGCGAAACCTGCTTCCACTTCAAGCTATATCGTCAACAATGGAGTCACTCATTCTTCAACTACACGAGATATCCGCCGTGAAATTTGGAAACTTTAAGTTGAAATCCGGCATCTCGTCCCCCATATACATCGACCTCCGCCTC...

CDS

Download CDS FASTA

1416 bp · TkA02G084010|TK1151|CDS

ATGGAGTCACTCATTCTTCAACTACACGAGATATCCGCCGTGAAATTTGGAAACTTTAAGTTGAAATCCGGCATCTCGTCCCCCATATACATCGACCTCCGCCTCATCGTATCATACCCAAAACTCCTCCGCCTCATATCCGACACCATTATCTCCACCCTCCCTCCTTCCGCCGTCTACGACGTCATCTGCGGCGTCCCTTACACCGCCCTCCCCATTGCCACCGTCATATCCACATCTTCCGATGTCCCAATGCTCAT...

Protein

Download Protein FASTA

471 aa · TkA02G084010|TK1151|PROTEIN

MESLILQLHEISAVKFGNFKLKSGISSPIYIDLRLIVSYPKLLRLISDTIISTLPPSAVYDVICGVPYTALPIATVISTSSDVPMLMRRKEIKDYGTSKVIEGAFQPNQICLVVEDLVTSGTSVLETAAPLRAAGLKVNDVVVLIDREQGGRENLAANGITLHSMIKLTDMVRVLREKGRVSEETEAMVHKFLEENKKVATVVAPPVSTSIKARIPYGDRAKLAKNPTGKKLFEIMVKKESNLCLSADVSTASELLAIAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G084010`
TK1151 ID	TkA02G084010
OH-1004 ID	LXL04_017017
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 99.367 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G084010

Location Chr02:21796360-21799215 (-)

Description Similar to PYR5-6: Uridine 5'-monophosphate synthase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54470`	Uridine 5'-monophosphate synthase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0951200`	Uridine 5'-monophosphate synthase.	No verified direct reference in this release
`Os01g0951400`	Uridine 5'-monophosphate synthase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process Biological Process

GO:0006222 UMP biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019856 pyrimidine nucleobase biosynthetic process Biological Process

GO:0044205 'de novo' UMP biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0004588 orotate phosphoribosyltransferase activity Molecular Function

GO:0004590 orotidine-5'-phosphate decarboxylase activity Molecular Function

KEGG gene cross-reference

ath:AT3G54470

dosa:Os01g0951200

dosa:Os01g0951400

pon:100173867

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.664

Rank 1 · TkA02G084010 · TK1151

Nucleus0.310

Rank 2 · TkA02G084010 · TK1151

Mitochondrion0.113

Rank 3 · TkA02G084010 · TK1151

Peroxisome0.095

Rank 4 · TkA02G084010 · TK1151

Cell membrane0.048

Rank 5 · TkA02G084010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00156Pribosyltran61-153 aa

PF00356LacI173-195 aa

PF00215OMPdecase179-203 aa

PF00215OMPdecase241-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G084010	`PF00156`	Pribosyltran	61	153	6.4e-07	29.5
TkA02G084010	`PF00356`	LacI	173	195	0.12	12.9
TkA02G084010	`PF00215`	OMPdecase	179	203	6e-61	206.9
TkA02G084010	`PF00215`	OMPdecase	241	459	6e-61	206.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42586`	Arabidopsis thaliana	sp\|Q42586\|UMPS_ARATH Uridine 5'-monophosphate synthase	76.700%	Swiss-Prot	High
`Q9LDN2`	Oryza sativa subsp. japonica	sp\|Q9LDN2\|UMPS1_ORYSJ Uridine 5'-monophosphate synthase	70.400%	Swiss-Prot	High
`Q8RZA1`	Oryza sativa subsp. japonica	sp\|Q8RZA1\|UMPS2_ORYSJ Uridine 5'-monophosphate synthase	67.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card