TkA02G082730 | RubberDandelionOmics

Gene overview

TkA02G082730

Reference: TK1151 Chr: Chr02 Coordinates: 21491537-21498437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3002 bp · TkA02G082730|TK1151|cDNA

CACGACTCTTATAAGATTCGTGTCCTTAATTTGCTGTTCATCAAAGTCTCGAATCATTTTAATCATCTTTCTCTTTACTTCCTCTCTCTCTCTCTCTCTAGAAATATCTATGTTTTTAAATTATTTTTGGTTGGTTCGTGTTTGAAAGTATTGGCGAATCACAGCGGATTGCTTCACATGGTGGGCAACATACAAAGAACTTTCTAAGATCGAAGTTGCAGAGGAGAAAGACAAATGCATCGTTGAGCAAGTTTGAAGAT...

CDS

Download CDS FASTA

2319 bp · TkA02G082730|TK1151|CDS

ATGGAGAATAATAATGTTGATATCGAAAGCGAAGGAGGAGAGAAGTTGGAGACAAATGGATCGATTTTTGAGGATAGGGATATGATTCGCGAACCACTGCTTATGAAGAGCAGAGTCAATACGACGTCGCAGATTGCCATCGTTGGTGCTAACATCTGTCCCATCGAGTCTCTTGATTACGAGATTGTAGAAAACGATCTGTTCAAGCAGGATTGGAGATCCAGGAAGAAGGTGCAGATATTTCAATACGTCGTTTTGAA...

Protein

Download Protein FASTA

772 aa · TkA02G082730|TK1151|PROTEIN

MENNNVDIESEGGEKLETNGSIFEDRDMIREPLLMKSRVNTTSQIAIVGANICPIESLDYEIVENDLFKQDWRSRKKVQIFQYVVLKWTLVLLIGIATGLVAFFNNIAVENIAGFKLLLTGNLMLKQKHFQAFAALAGCNVVLATCAGVLCAYVAPAAAGSGIPEVKAYLNGVDAHSILAPSTLFVKIFGSIFGVAAGFVVGKEGPMVHTGACIANLLGQGGSRKYHLTWKWLRYFKNDRDRRDLITCGAAAGVAAAFRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G082730`
TK1151 ID	TkA02G082730
OH-1004 ID	LXL04_017025
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G082730

Location Chr02:21491537-21498437 (-)

Description Similar to CLC-C: Chloride channel protein CLC-c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49890`	Voltage-gated chloride channel.	No verified direct reference in this release
`At5g33280`	Putative voltage-gated chloride channel.	No verified direct reference in this release
`At3g27170`	Voltage-gated chloride channel.	No verified direct reference in this release
`At5g40890`	Voltage-gated chloride channel that could play a role in the regulation of nitrate content.	Disruption of putative anion channel gene AtCLC-a in Arabidopsis suggests a role in the regulation of nitrate content.2000 · DOI: 10.1046/j.1365-313x.2000.00680.x
`At5g26240`	Voltage-gated chloride channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017025 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006821 chloride transport Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0034707 chloride channel complex Cellular Component

KEGG gene cross-reference

ath:AT3G27170

ath:AT5G26240

ath:AT5G33280

ath:AT5G40890

ath:AT5G49890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.350

Rank 1 · TkA02G082730 · TK1151

Cell membrane0.301

Rank 2 · TkA02G082730 · TK1151

Cytoplasm0.220

Rank 3 · TkA02G082730 · TK1151

Golgi apparatus0.129

Rank 4 · TkA02G082730 · TK1151

Endoplasmic reticulum0.123

Rank 5 · TkA02G082730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00654Voltage_CLC85-115 aa

PF00654Voltage_CLC144-558 aa

PF27507DjlA_TM188-202 aa

PF10518TAT_signal241-258 aa

PF27507DjlA_TM333-357 aa

PF00571CBS591-649 aa

PF00571CBS705-755 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G082730	`PF00654`	Voltage_CLC	85	115	3.4e-81	273.8
TkA02G082730	`PF00654`	Voltage_CLC	144	558	3.4e-81	273.8
TkA02G082730	`PF27507`	DjlA_TM	188	202	0.23	12.4
TkA02G082730	`PF10518`	TAT_signal	241	258	0.1	13.3
TkA02G082730	`PF27507`	DjlA_TM	333	357	0.23	12.4
TkA02G082730	`PF00571`	CBS	591	649	1.1e-07	32.7
TkA02G082730	`PF00571`	CBS	705	755	1.1e-07	32.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96282`	Arabidopsis thaliana	sp\|Q96282\|CLCC_ARATH Chloride channel protein CLC-c	76.400%	Swiss-Prot	High
`P60300`	Arabidopsis thaliana	sp\|P60300\|CLCG_ARATH Putative chloride channel-like protein CLC-g	61.300%	Swiss-Prot	High
`P92942`	Arabidopsis thaliana	sp\|P92942\|CLCB_ARATH Chloride channel protein CLC-b	55.500%	Swiss-Prot	High
`P92941`	Arabidopsis thaliana	sp\|P92941\|CLCA_ARATH Chloride channel protein CLC-a	55.000%	Swiss-Prot	High
`P92943`	Arabidopsis thaliana	sp\|P92943\|CLCD_ARATH Chloride channel protein CLC-d	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card