TkA02G081580 | RubberDandelionOmics

Gene overview

TkA02G081580

Reference: TK1151 Chr: Chr02 Coordinates: 21205684-21206749 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

517 bp · TkA02G081580|TK1151|cDNA

GAGTGATCGACGGAAAATGGGTCATGGGAGTTCCAAATCAAGCTCCTCTGATGACTCCTCAAACGGCGGTGGTTCCAATTCAAAACAACGCGGCTCCCGCCGCGAGAAAATCAAAACGAAGCTTCATCTTCACCGGCGCCGTTCCCATTCGCAGCTCCCAAAACTCATCAGCTCAGAGGATTTTGCCGGCATCGCGTTGGTCACCCTTATATGTGCGGAGATGAAATTCAAGGATAAGTGGCTTGCTTGTATTTCAATCG...

CDS

Download CDS FASTA

501 bp · TkA02G081580|TK1151|CDS

ATGGGTCATGGGAGTTCCAAATCAAGCTCCTCTGATGACTCCTCAAACGGCGGTGGTTCCAATTCAAAACAACGCGGCTCCCGCCGCGAGAAAATCAAAACGAAGCTTCATCTTCACCGGCGCCGTTCCCATTCGCAGCTCCCAAAACTCATCAGCTCAGAGGATTTTGCCGGCATCGCGTTGGTCACCCTTATATGTGCGGAGATGAAATTCAAGGATAAGTGGCTTGCTTGTATTTCAATCGGAGAACAGACGTTTCG...

Protein

Download Protein FASTA

167 aa · TkA02G081580|TK1151|PROTEIN

MGHGSSKSSSSDDSSNGGGSNSKQRGSRREKIKTKLHLHRRRSHSQLPKLISSEDFAGIALVTLICAEMKFKDKWLACISIGEQTFRTEISDQTNKPTWNSEIKLFLERNGPHVAKISVFETNRLRKNNLIGYCEVDLFEFLTQDSGSDIKVSLMDPSSSSVVVGNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G081580`
TK1151 ID	TkA02G081580
OH-1004 ID	LXL04_017036
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 87.425 / OH-1004 20.651 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G081580

Location Chr02:21205684-21206749 (-)

Description Similar to PSD2: Phosphatidylserine decarboxylase proenzyme 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57190`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	Deficiency in phosphatidylserine decarboxylase activity in the psd1 psd2 psd3 triple mutant of Arabidopsis affects phosphatidylethanolamine accumulation in mitochondria.2007 · DOI: 10.1104/pp.107.095414
`At4g25970`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	Deficiency in phosphatidylserine decarboxylase activity in the psd1 psd2 psd3 triple mutant of Arabidopsis affects phosphatidylethanolamine accumulation in mitochondria.2007 · DOI: 10.1104/pp.107.095414

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0959800`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017036 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0016540 protein autoprocessing Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT4G25970

ath:AT5G57190

dosa:Os01g0959800

ppa:PAS_chr3_1127

spo:2543178

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.405

Rank 1 · TkA02G081580 · TK1151

Cytoplasm0.375

Rank 2 · TkA02G081580 · TK1151

Nucleus0.280

Rank 3 · TkA02G081580 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA02G081580 · TK1151

Golgi apparatus0.058

Rank 5 · TkA02G081580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257Dehydrin4-45 aa

PF07162B9-C268-162 aa

PF00168C278-145 aa

PF10358NT-C293-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G081580	`PF00257`	Dehydrin	4	45	0.22	12.7
TkA02G081580	`PF07162`	B9-C2	68	162	0.11	13.3
TkA02G081580	`PF00168`	C2	78	145	3.1e-08	34.5
TkA02G081580	`PF10358`	NT-C2	93	160	0.01	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAK5`	Arabidopsis thaliana	sp\|F4KAK5\|PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2	57.400%	Swiss-Prot	High
`A4GNA8`	Arabidopsis thaliana	sp\|A4GNA8\|PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3	57.700%	Swiss-Prot	High
`Q5JN42`	Oryza sativa subsp. japonica	sp\|Q5JN42\|PSD2_ORYSJ Phosphatidylserine decarboxylase proenzyme 2	62.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card