TkA02G081560 | RubberDandelionOmics

Gene overview

TkA02G081560

Reference: TK1151 Chr: Chr02 Coordinates: 21193291-21200394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1842 bp · TkA02G081560|TK1151|cDNA

GTGCTCACATAAAGTCATAAACCCTGAGGCCAGCGTTCCCTCCTTTCTCCGCCTCCCACTCTTCCATCTTTAGGGTTTCTGCTACTTCTCCACCACTATCCATCATCGTCAACTTTTATTGGAATCAAGAGATAATCAAAGAAAAAGAAAGCAGCAAAGAATGTGGTATCTCTGTGTCTTTTACCACAGATTACTGGATTACAGGAAACCCGAATTCGAAGCTCTAGCAGACCTCTTCGGCGCATTCGACAATAACAATC...

CDS

Download CDS FASTA

1449 bp · TkA02G081560|TK1151|CDS

ATGTGGTATCTCTGTGTCTTTTACCACAGATTACTGGATTACAGGAAACCCGAATTCGAAGCTCTAGCAGACCTCTTCGGCGCATTCGACAATAACAATCCAAGCAGTTCACATTCACTCGAATGGAAGCTACCTGAGCATCACCATCCCGATTCTCCTTTCCACTTCGTCAATCTTCCTTCCGAAGATATCGCACGCAACATCGCCAATCGAAGTATACTCGTGAAAGGAGTTTATGAAATTTGGGGAGAGGGAAGCTC...

Protein

Download Protein FASTA

482 aa · TkA02G081560|TK1151|PROTEIN

MWYLCVFYHRLLDYRKPEFEALADLFGAFDNNNPSSSHSLEWKLPEHHHPDSPFHFVNLPSEDIARNIANRSILVKGVYEIWGEGSSYEELKEAVNSYPDDRKLPYLTSDSTFRLIVDRFGKAISFKDQTALIKGMSYIPFKGKVDLRNPEHKFWLIETDDYESNNGLPPIVDKRVFFGREIGGADRKLLPTYELKSRNYLGPTAMDAEVAFLMANQAQAMPGKLVYDPFVGTGSILVAAAHFGAMTMGADIDIRVVRDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G081560`
TK1151 ID	TkA02G081560
OH-1004 ID	LXL04_017037
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G081560

Location Chr02:21193291-21200394 (+)

Description Similar to trmt11: tRNA (guanine(10)-N2)-methyltransferase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03050`	Putative clathrin assembly protein At1g03050.	No verified direct reference in this release
`At4g02650`	Putative clathrin assembly protein At4g02650.	No verified direct reference in this release
`At4g32285`	Probable clathrin assembly protein At4g32285.	No verified direct reference in this release
`At2g25430`	Putative clathrin assembly protein At2g25430.	No verified direct reference in this release
`At1g05020`	Adaptins are components of the adapter complexes which link clathrin to receptors in coated vesicles.	Identification and functional characterization of Arabidopsis AP180, a binding partner of plant alphaC-adaptin.2004 · DOI: 10.1242/jcs.01062

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017037 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008033 tRNA processing Biological Process

GO:0032259 methylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0034708 methyltransferase complex Cellular Component

GO:0043528 tRNA (m2G10) methyltransferase complex Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0160102 tRNA (guanine(10)-N2)-methyltransferase activity Molecular Function

KEGG gene cross-reference

gga:378793

mmu:73681

pon:100174524

rno:378794

xla:432012

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.564

Rank 1 · TkA02G081560 · TK1151

Cytoplasm0.322

Rank 2 · TkA02G081560 · TK1151

Mitochondrion0.132

Rank 3 · TkA02G081560 · TK1151

Cell membrane0.025

Rank 4 · TkA02G081560 · TK1151

Plastid0.023

Rank 5 · TkA02G081560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25904Tmrp11_N2-187 aa

PF01170UPF0020197-319 aa

PF02384N6_Mtase209-247 aa

PF01555N6_N4_Mtase221-257 aa

PF01555N6_N4_Mtase301-374 aa

PF01170UPF0020356-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G081560	`PF25904`	Tmrp11_N	2	187	8.2e-31	107.5
TkA02G081560	`PF01170`	UPF0020	197	319	6.7e-13	49.5
TkA02G081560	`PF02384`	N6_Mtase	209	247	0.018	15.1
TkA02G081560	`PF01555`	N6_N4_Mtase	221	257	3.8e-05	24.5
TkA02G081560	`PF01555`	N6_N4_Mtase	301	374	3.8e-05	24.5
TkA02G081560	`PF01170`	UPF0020	356	380	6.7e-13	49.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA65`	Arabidopsis thaliana	sp\|Q9SA65\|CAP4_ARATH Putative clathrin assembly protein At1g03050	52.700%	Swiss-Prot	High
`Q8GX47`	Arabidopsis thaliana	sp\|Q8GX47\|CAP3_ARATH Putative clathrin assembly protein At4g02650	52.800%	Swiss-Prot	High
`Q8S9J8`	Arabidopsis thaliana	sp\|Q8S9J8\|CAP1_ARATH Probable clathrin assembly protein At4g32285	44.300%	Swiss-Prot	Medium
`Q8LF20`	Arabidopsis thaliana	sp\|Q8LF20\|CAP2_ARATH Putative clathrin assembly protein At2g25430	42.500%	Swiss-Prot	Medium
`Q9ZVN6`	Arabidopsis thaliana	sp\|Q9ZVN6\|AP180_ARATH Clathrin coat assembly protein AP180	36.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card