TkA02G080520 | RubberDandelionOmics

Gene overview

TkA02G080520

Reference: TK1151 Chr: Chr02 Coordinates: 20934583-20937963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1486 bp · TkA02G080520|TK1151|cDNA

ATAAAGCGAGGTTCAGTTTTCTCATATCCAAACCTGAGTTCATAAGTTCTGAGTTTTTTTAACAACTGAATAAGTTTCGAGTTTTATCTGGAGAGAGATAGAGATAGAAAGACAGAGAGAGCTAATTAATGGCTGAGATTAAGAAACAAGGGTTGAAGGCAACAATGATGATGATTGTAACTGAACTGATAATGGCAGGGACTAGTATCTTTTATAAATTGGCCTCAAATGATGGAATGCAGATGAGTGTTTTGATTGCA...

CDS

Download CDS FASTA

1191 bp · TkA02G080520|TK1151|CDS

ATGGCTGAGATTAAGAAACAAGGGTTGAAGGCAACAATGATGATGATTGTAACTGAACTGATAATGGCAGGGACTAGTATCTTTTATAAATTGGCCTCAAATGATGGAATGCAGATGAGTGTTTTGATTGCATATCGCTATTTGTTTGCTTCCATTCTATTTTTTCCTCTAGCTCTGTTCATCGAAAGAAACAAAAGACCAAAGCTAACAAAGATGATACTCTTCCAAGCATTTCTTTGTGCGGTTTTCGGGGGTCCAAT...

Protein

Download Protein FASTA

396 aa · TkA02G080520|TK1151|PROTEIN

MAEIKKQGLKATMMMIVTELIMAGTSIFYKLASNDGMQMSVLIAYRYLFASILFFPLALFIERNKRPKLTKMILFQAFLCAVFGGPMAQNLFAESLVLTSATFATAFTNLIPPITIIMAALFRLERVEISIMSGTAKVIGIIVGVGGAMLLTFYKGRQLNTLSTHFNIVHGGQHMDRHIRTIHKTPIHHILGSLSALAASLSLALYLILQAKLSASYPCHYSNTFMISVMGFIQSFGFALCTERSWSQWKLGWNVRLLAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G080520`
TK1151 ID	TkA02G080520
OH-1004 ID	LXL04_017029
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 84.091 / OH-1004 45.306 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G080520

Location Chr02:20934583-20937963 (+)

Description Similar to At1g25270: WAT1-related protein At1g25270

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68170`	WAT1-related protein At1g68170.	No verified direct reference in this release
`At1g25270`	WAT1-related protein At1g25270.	No verified direct reference in this release
`At1g09380`	WAT1-related protein At1g09380.	No verified direct reference in this release
`At5g13670`	WAT1-related protein At5g13670.	No verified direct reference in this release
`At2g37460`	WAT1-related protein At2g37460.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017029 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G25270

ath:AT1G68170

ath:AT4G08300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.602

Rank 1 · TkA02G080520 · TK1151

Endoplasmic reticulum0.172

Rank 2 · TkA02G080520 · TK1151

Lysosome / Vacuole0.131

Rank 3 · TkA02G080520 · TK1151

Cytoplasm0.064

Rank 4 · TkA02G080520 · TK1151

Golgi apparatus0.055

Rank 5 · TkA02G080520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA11-151 aa

PF00892EamA191-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G080520	`PF00892`	EamA	11	151	4.5e-26	92.5
TkA02G080520	`PF00892`	EamA	191	328	4.5e-26	92.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVM3`	Arabidopsis thaliana	sp\|F4HVM3\|WTR10_ARATH WAT1-related protein At1g68170	39.700%	Swiss-Prot	Medium
`Q4PT23`	Arabidopsis thaliana	sp\|Q4PT23\|WTR6_ARATH WAT1-related protein At1g25270	37.400%	Swiss-Prot	Medium
`Q8GXB4`	Arabidopsis thaliana	sp\|Q8GXB4\|WTR2_ARATH WAT1-related protein At1g09380	38.800%	Swiss-Prot	Medium
`Q9FNA5`	Arabidopsis thaliana	sp\|Q9FNA5\|WTR39_ARATH WAT1-related protein At5g13670	40.600%	Swiss-Prot	Medium
`Q9ZUS1`	Arabidopsis thaliana	sp\|Q9ZUS1\|WTR13_ARATH WAT1-related protein At2g37460	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card