TkA02G077760 | RubberDandelionOmics

Gene overview

TkA02G077760

Reference: TK1151 Chr: Chr02 Coordinates: 20242522-20248251 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2459 bp · TkA02G077760|TK1151|cDNA

ATTAAATGGCTTCATCCCTGTCTTGACTAATCTCTCCATCACTTTCTCTCTGCAACCAGTTGTCTTTTTAGTATAAAAGAATACGAACTTTGACCAACAACCTACAGACTCCAACTTTACCCCAAATCCCACATCAAATTTACTCCAAAGTTACCATTTTCAGACTTTTTTAAATTGGGTTTTCCTGTTTTAGCTTCTTGATGTTATATAACTGTTTGCTTGAGCTGTATTCAAACCTAGCGTTTGCTGTTTCTGGGTTT...

CDS

Download CDS FASTA

1842 bp · TkA02G077760|TK1151|CDS

ATGGATCGAACAGTCTCTCTAATCACCCTTTGGTTTATATTCGGGTTCTATAATTTATCAAGGGTATACGGGAATGCAGAAGGTGATGCATTGAATGCCCTAAAGACGCAATTACGAGATCCTGCTAATATTTTACAAAGTTGGGATCCGACTCTAGTCAATCCGTGTACATGGTTTCATATTACTTGTGACCCTCAGAATAGCGTTTCTAGACTTGATCTTGGAAACGCACAATTGTCTGGTCAACTGGTTCCGCAGCT...

Protein

Download Protein FASTA

613 aa · TkA02G077760|TK1151|PROTEIN

MDRTVSLITLWFIFGFYNLSRVYGNAEGDALNALKTQLRDPANILQSWDPTLVNPCTWFHITCDPQNSVSRLDLGNAQLSGQLVPQLGQLPKLQYLELYGNNLTGTIPPELGNLTELMSLDLYMNKFEGGIPDSLGNLKKLRFFRLNNNTLTGTIPNSLTTIETLQVLDLSNNNLSGTVPDNGSFSLFTPISYEGNPNLILPATRPTPPAEPNSQSSSVGNSATGAIAGGVAAGAALLFAGPAIVLAYWRRRKPQDHFFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G077760`
TK1151 ID	TkA02G077760
OH-1004 ID	LXL04_017056
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G077760

Location Chr02:20242522-20248251 (-)

Description Similar to BAK1: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33430`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	The BRI1-associated kinase 1, BAK1, has a brassinolide-independent role in plant cell-death control.2007 · DOI: 10.1016/j.cub.2007.05.046 BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 The Arabidopsis leucine-rich repeat receptor-like kinases BAK1/SERK3 and BKK1/SERK4 are required for innate immunity to hemibiotrophic and biotrophic pathogens.2011 · DOI: 10.1105/tpc.111.084301 Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140 The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery454 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At1g34210`	Serine/threonine-kinase involved in brassinosteroid-dependent and -independent signaling pathways.	Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216
`At1g71830`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	Role of threonines in the Arabidopsis thaliana somatic embryogenesis receptor kinase 1 activation loop in phosphorylation.2001 · DOI: 10.1074/jbc.m102381200 In vivo hexamerization and characterization of the Arabidopsis AAA ATPase CDC48A complex using forster resonance energy transfer-fluorescence lifetime imaging microscopy and fluorescence correlation spectroscopy.2007 · DOI: 10.1104/pp.107.103986

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017056 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0030154 cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G71830

ath:AT4G33430

dosa:Os04g0457800

dosa:Os08g0174700

osa:4336035

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884

Rank 1 · TkA02G077760 · TK1151

Cytoplasm0.080

Rank 2 · TkA02G077760 · TK1151

Endoplasmic reticulum0.073

Rank 3 · TkA02G077760 · TK1151

Nucleus0.047

Rank 4 · TkA02G077760 · TK1151

Lysosome / Vacuole0.020

Rank 5 · TkA02G077760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_225-64 aa

PF25013LRR_Zer-164-178 aa

PF25019LRR_R13L1-DRL2168-99 aa

PF00560LRR_170-90 aa

PF12799LRR_471-108 aa

PF23598LRR_1472-172 aa

PF13855LRR_872-126 aa

PF24141LRR_ComC75-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G077760	`PF08263`	LRRNT_2	25	64	2.5e-10	41.2
TkA02G077760	`PF25013`	LRR_Zer-1	64	178	0.017	15.9
TkA02G077760	`PF25019`	LRR_R13L1-DRL21	68	99	0.16	12.6
TkA02G077760	`PF00560`	LRR_1	70	90	1e-15	55.2
TkA02G077760	`PF12799`	LRR_4	71	108	3.9e-07	30.8
TkA02G077760	`PF23598`	LRR_14	72	172	1.2e-09	38.2
TkA02G077760	`PF13855`	LRR_8	72	126	4e-07	30.4
TkA02G077760	`PF24141`	LRR_ComC	75	108	0.048	14.0
TkA02G077760	`PF23211`	LRR_LRWD1	78	112	2.2e-06	28.2
TkA02G077760	`PF25019`	LRR_R13L1-DRL21	84	146	0.16	12.6
TkA02G077760	`PF13516`	LRR_6	90	105	5.4	8.0
TkA02G077760	`PF12799`	LRR_4	91	126	3.9e-07	30.8
TkA02G077760	`PF13855`	LRR_8	91	151	4e-07	30.4
TkA02G077760	`PF00560`	LRR_1	92	114	1e-15	55.2
TkA02G077760	`PF13855`	LRR_8	116	175	4e-07	30.4
TkA02G077760	`PF00560`	LRR_1	117	138	1e-15	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94F62`	Arabidopsis thaliana	sp\|Q94F62\|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	81.800%	Swiss-Prot	High
`Q9XIC7`	Arabidopsis thaliana	sp\|Q9XIC7\|SERK2_ARATH Somatic embryogenesis receptor kinase 2	78.700%	Swiss-Prot	High
`Q94AG2`	Arabidopsis thaliana	sp\|Q94AG2\|SERK1_ARATH Somatic embryogenesis receptor kinase 1	79.800%	Swiss-Prot	High
`B8BB68`	Oryza sativa subsp. indica	sp\|B8BB68\|BAK1_ORYSI LRR receptor kinase BAK1	79.200%	Swiss-Prot	High
`Q6Z4U4`	Oryza sativa subsp. japonica	sp\|Q6Z4U4\|BAK1_ORYSJ LRR receptor kinase BAK1	79.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card