TkA02G076840 | RubberDandelionOmics

Gene overview

TkA02G076840

Reference: TK1151 Chr: Chr02 Coordinates: 19953106-19957379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3697 bp · TkA02G076840|TK1151|cDNA

TTTCAGAATTTCTACTTTATTTTTTCCTCATCAACAACAACTATGTCGGCAGCCACCGGAGATCAACCCTCCACCTCCTTTTCCACAGATGGTTCACAACCATGTCGCCGGTTTGAATTTACCGAGATTCTCTCAGCGACCGACAACTTTAACGAATCATTAGTAGTTGGGCATGGAGGATTTGGAAAAGTTTACAAAGGTAAAATTCTCAATGGATCCACTCTTGTTCTTGCCGCCATCAAACGGCTGGATTCCATGTC...

CDS

Download CDS FASTA

2313 bp · TkA02G076840|TK1151|CDS

ATGTCGGCAGCCACCGGAGATCAACCCTCCACCTCCTTTTCCACAGATGGTTCACAACCATGTCGCCGGTTTGAATTTACCGAGATTCTCTCAGCGACCGACAACTTTAACGAATCATTAGTAGTTGGGCATGGAGGATTTGGAAAAGTTTACAAAGGTAAAATTCTCAATGGATCCACTCTTGTTCTTGCCGCCATCAAACGGCTGGATTCCATGTCCAATCAAGGGGAAGAAGAGTTTTGGGCGGAAGTTGAGATGCT...

Protein

Download Protein FASTA

770 aa · TkA02G076840|TK1151|PROTEIN

MSAATGDQPSTSFSTDGSQPCRRFEFTEILSATDNFNESLVVGHGGFGKVYKGKILNGSTLVLAAIKRLDSMSNQGEEEFWAEVEMLSKLRHSHLVSLFGYCNYETEKILIYEYMPNGTLEDHLHKLGTRLSWLQRLKICIGAARGLDYLHTGTGIETGVIHRDVKTSNILLHESWAAKISDFGLSRIAPTNQQSTYVKTLVKGTFGYFDPNYFATGSLTRKSDVYAFGVVLFEVLCRKRAVDKSLDDEQWGLVSWVQDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G076840`
TK1151 ID	TkA02G076840
OH-1004 ID	LXL04_017063
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.400
Protein coverage (%)	TK1151 91.948 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G076840

Location Chr02:19953106-19957379 (-)

Description Similar to BAK1: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g13790`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At4g33430`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	The BRI1-associated kinase 1, BAK1, has a brassinolide-independent role in plant cell-death control.2007 · DOI: 10.1016/j.cub.2007.05.046 BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 The Arabidopsis leucine-rich repeat receptor-like kinases BAK1/SERK3 and BKK1/SERK4 are required for innate immunity to hemibiotrophic and biotrophic pathogens.2011 · DOI: 10.1105/tpc.111.084301 Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140 The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery454 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At2g13800`	Serine/threonine-kinase of unknown function.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017063 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G34210

ath:AT1G71830

ath:AT4G33430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.662

Rank 1 · TkA02G076840 · TK1151

Cytoplasm0.269

Rank 2 · TkA02G076840 · TK1151

Nucleus0.203

Rank 3 · TkA02G076840 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA02G076840 · TK1151

Golgi apparatus0.034

Rank 5 · TkA02G076840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase40-312 aa

PF07714PK_Tyr_Ser-Thr41-310 aa

PF03109ABC147-62 aa

PF03109ABC1103-203 aa

PF14531Kinase-like158-243 aa

PF00069Pkinase383-650 aa

PF07714PK_Tyr_Ser-Thr384-652 aa

PF03109ABC1386-412 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G076840	`PF00069`	Pkinase	40	312	5.3e-74	249.6
TkA02G076840	`PF07714`	PK_Tyr_Ser-Thr	41	310	6.8e-86	288.5
TkA02G076840	`PF03109`	ABC1	47	62	1.1e-05	25.4
TkA02G076840	`PF03109`	ABC1	103	203	1.1e-05	25.4
TkA02G076840	`PF14531`	Kinase-like	158	243	0.035	14.1
TkA02G076840	`PF00069`	Pkinase	383	650	5.3e-74	249.6
TkA02G076840	`PF07714`	PK_Tyr_Ser-Thr	384	652	6.8e-86	288.5
TkA02G076840	`PF03109`	ABC1	386	412	1.1e-05	25.4
TkA02G076840	`PF14531`	Kinase-like	470	525	0.035	14.1
TkA02G076840	`PF30149`	YGR130C_C	620	671	0.23	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKG5`	Arabidopsis thaliana	sp\|Q9SKG5\|SERK4_ARATH Somatic embryogenesis receptor kinase 4	62.300%	Swiss-Prot	Low
`Q94F62`	Arabidopsis thaliana	sp\|Q94F62\|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	68.200%	Swiss-Prot	Low
`Q8LPS5`	Arabidopsis thaliana	sp\|Q8LPS5\|SERK5_ARATH Somatic embryogenesis receptor kinase 5	61.100%	Swiss-Prot	Low
`B8BB68`	Oryza sativa subsp. indica	sp\|B8BB68\|BAK1_ORYSI LRR receptor kinase BAK1	66.600%	Swiss-Prot	Low
`Q6Z4U4`	Oryza sativa subsp. japonica	sp\|Q6Z4U4\|BAK1_ORYSJ LRR receptor kinase BAK1	66.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card