TkA02G076730 | RubberDandelionOmics

Gene overview

TkA02G076730

Reference: TK1151 Chr: Chr02 Coordinates: 19919839-19923057 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2037 bp · TkA02G076730|TK1151|cDNA

AAAAAATCTACTTCATTCGTTCGGAAGGAAATTTTCCTTTTTATATAGATATACAAAATTGATTGACATAGTGTACTTGCCTAAATAGAACATAAGGTCACAGATGGCAGACTGAGTAACAGAGATAGCAAGAATTCTTGTTCCCGGAGTTTGGATTTTGATATCCAGCAAACGATATCCCTGAAAGTGCTCTTACCTGTATCCAACAAAACCCTAGTTCCAATCTCATTTTTTACCAGGTCAGTATCGATCTACAGTTC...

CDS

Download CDS FASTA

1317 bp · TkA02G076730|TK1151|CDS

ATGGGTGGTTTACTAAGCGTAACCAGCTCTAAACCAAACGAATCCCTCCAAATCTCCCAATCCGAATCCAACAAGAGACAGAAAACCTCACCAACCCTCTGGGACGACAACCCTAGATTAATCCCCAATCTCCCCGATGAAATCTCCCTCTTAATCCTCGCACGCCTCCCCAGAATCTGCTACCTAACCGTCAAATCAGTCTCACGTACCTGGAAATTAGCAGTCACAACTCCCGAAATCTACAAAGTCAGAAAAGAACT...

Protein

Download Protein FASTA

438 aa · TkA02G076730|TK1151|PROTEIN

MGGLLSVTSSKPNESLQISQSESNKRQKTSPTLWDDNPRLIPNLPDEISLLILARLPRICYLTVKSVSRTWKLAVTTPEIYKVRKELGTTEEWLYILTKNQNDRLFWHALDPLSKKWQKLPPIPDLPSQHPPKHKHKWGPSARLADTVRGWLGRTNGPDQIPLCGCAIGAVDGSLYMLGGFSKSTAVNSVYKYDPVSNKWTESTSMCVGRAYCKTGVLNNKLFVVGGVSRCRGGLTPLQSAEVFDPKTGVWSEIPNMPFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G076730`
TK1151 ID	TkA02G076730
OH-1004 ID	LXL04_017077
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 95.434 / OH-1004 61.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G076730

Location Chr02:19919839-19923057 (+)

Description Similar to At1g22040: F-box/kelch-repeat protein At1g22040

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22040`	F-box/kelch-repeat protein At1g22040.	No verified direct reference in this release
`At1g30090`	F-box/kelch-repeat protein At1g30090.	No verified direct reference in this release
`At3g63220`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g60570`	Putative F-box/kelch-repeat protein At1g60570.	No verified direct reference in this release
`At5g39560`	F-box/kelch-repeat protein At5g39560.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017077 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G22040

ath:AT1G30090

ath:AT1G55270

ath:AT1G67480

ath:AT2G24540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.542

Rank 1 · TkA02G076730 · TK1151

Cytoplasm0.400

Rank 2 · TkA02G076730 · TK1151

Cell membrane0.118

Rank 3 · TkA02G076730 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA02G076730 · TK1151

Plastid0.033

Rank 5 · TkA02G076730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box41-82 aa

PF12937F-box-like41-82 aa

PF24681Kelch_KLHDC2_KLHL20_DRC767-129 aa

PF03478Beta-prop_KIB1-475-158 aa

PF13964Beta-prop_Calicin98-123 aa

PF24996NANM100-124 aa

PF07646Kelch_2107-124 aa

PF01344Kelch_1109-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G076730	`PF00646`	F-box	41	82	1.2e-07	32.0
TkA02G076730	`PF12937`	F-box-like	41	82	4.9e-06	26.9
TkA02G076730	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	67	129	5.2e-14	52.8
TkA02G076730	`PF03478`	Beta-prop_KIB1-4	75	158	0.002	18.4
TkA02G076730	`PF13964`	Beta-prop_Calicin	98	123	2.2e-10	40.8
TkA02G076730	`PF24996`	NANM	100	124	2.7e-05	23.9
TkA02G076730	`PF07646`	Kelch_2	107	124	2.5e-17	62.6
TkA02G076730	`PF01344`	Kelch_1	109	122	2.7e-30	104.2
TkA02G076730	`PF25210`	Kelch_FKB95	109	121	2.2e-19	70.8
TkA02G076730	`PF00646`	F-box	113	120	1.2e-07	32.0
TkA02G076730	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	155	257	5.2e-14	52.8
TkA02G076730	`PF01344`	Kelch_1	162	206	2.7e-30	104.2
TkA02G076730	`PF07646`	Kelch_2	162	207	2.5e-17	62.6
TkA02G076730	`PF13964`	Beta-prop_Calicin	163	257	2.2e-10	40.8
TkA02G076730	`PF25210`	Kelch_FKB95	166	401	2.2e-19	70.8
TkA02G076730	`PF24996`	NANM	167	229	2.7e-05	23.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM55`	Arabidopsis thaliana	sp\|Q9LM55\|FBK8_ARATH F-box/kelch-repeat protein At1g22040	61.100%	Swiss-Prot	High
`Q9C6Z0`	Arabidopsis thaliana	sp\|Q9C6Z0\|FBK17_ARATH F-box/kelch-repeat protein At1g30090	28.500%	Swiss-Prot	Low
`Q9M1W7`	Arabidopsis thaliana	sp\|Q9M1W7\|SKI30_ARATH F-box/kelch-repeat protein SKIP30	26.600%	Swiss-Prot	Low
`O22698`	Arabidopsis thaliana	sp\|O22698\|FBK24_ARATH Putative F-box/kelch-repeat protein At1g60570	26.500%	Swiss-Prot	Low
`Q6NL02`	Arabidopsis thaliana	sp\|Q6NL02\|FK131_ARATH F-box/kelch-repeat protein At5g39560	23.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card