TkA02G075980 | RubberDandelionOmics

Gene overview

TkA02G075980

Reference: TK1151 Chr: Chr02 Coordinates: 19653638-19654578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA02G075980|TK1151|cDNA

TTCCCATTTCCTTCATCAAACCGCCATTTTCAGTTTGCTTCCCCTCTCTCTCTCACTCTGATCTCTCAAAATGAAGAAATTACGTGCAATCGTGGTTGATGATGACAGTGGACAGCGCATGTACGCCGCCCGGATGCTCCGGACATCACCATTTGAAGTAATAGCTTCTGTTGAAAGTGGAGAAGCTGCTCTCAAATTCCTTGGATTAACGGCAGAAAATGAGGTGAAGGTCGATGTAGATTTGATACTGAGCGATCATG...

CDS

Download CDS FASTA

390 bp · TkA02G075980|TK1151|CDS

ATGAAGAAATTACGTGCAATCGTGGTTGATGATGACAGTGGACAGCGCATGTACGCCGCCCGGATGCTCCGGACATCACCATTTGAAGTAATAGCTTCTGTTGAAAGTGGAGAAGCTGCTCTCAAATTCCTTGGATTAACGGCAGAAAATGAGGTGAAGGTCGATGTAGATTTGATACTGAGCGATCATGATATGACAGGAATTAGTGGTTATGAGCTGCTCCTGGAACTCAAGAATTCAGAACTAAACAACGTGGCTGT...

Protein

Download Protein FASTA

129 aa · TkA02G075980|TK1151|PROTEIN

MKKLRAIVVDDDSGQRMYAARMLRTSPFEVIASVESGEAALKFLGLTAENEVKVDVDLILSDHDMTGISGYELLLELKNSELNNVAVVIISADGHEERIKKCMDGGALMFLEKPLRAKDVANLYNAIVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G075980`
TK1151 ID	TkA02G075980
OH-1004 ID	LXL04_022544
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G075980

Location Chr02:19653638-19654578 (-)

Description Similar to RR10: Two-component response regulator ORR10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41310`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XYV5`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`Os04g0673300`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`UniProt: Q4GZK7`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`Os01g0952500`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022544 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0048830 adventitious root development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

dosa:Os04g0442300

dosa:Os11g0143300

dosa:Os12g0139400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.609

Rank 1 · TkA02G075980 · TK1151

Nucleus0.563

Rank 2 · TkA02G075980 · TK1151

Mitochondrion0.043

Rank 3 · TkA02G075980 · TK1151

Cell membrane0.033

Rank 4 · TkA02G075980 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA02G075980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072Response_reg7-121 aa

PF01408GFO_IDH_MocA64-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G075980	`PF00072`	Response_reg	7	121	4.6e-19	69.3
TkA02G075980	`PF01408`	GFO_IDH_MocA	64	123	0.00029	22.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80365`	Arabidopsis thaliana	sp\|O80365\|ARR8_ARATH Two-component response regulator ARR8	32.800%	Swiss-Prot	Medium
`A2XYV5`	Oryza sativa subsp. indica	sp\|A2XYV5\|ORR6_ORYSI Two-component response regulator ORR6	38.100%	Swiss-Prot	Medium
`Q7XQA6`	Oryza sativa subsp. japonica	sp\|Q7XQA6\|ORR6_ORYSJ Two-component response regulator ORR6	38.100%	Swiss-Prot	Medium
`Q4GZK7`	Oryza sativa subsp. indica	sp\|Q4GZK7\|ORR4_ORYSI Two-component response regulator ORR4	32.600%	Swiss-Prot	Medium
`Q942A1`	Oryza sativa subsp. japonica	sp\|Q942A1\|ORR4_ORYSJ Two-component response regulator ORR4	32.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card