TkA02G075540 | RubberDandelionOmics

Gene overview

TkA02G075540

Reference: TK1151 Chr: Chr02 Coordinates: 19558446-19559044 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA02G075540|TK1151|cDNA

GATATTGAGAATATAACAGAAACTTCATTAAACAGACAAAAACAACTTGTTGATAGTCAGAATGCTGCACTTGAAGTTCTTCAAACCGTAACAAGTTTTCAGTCACAAGCACTCGAAGAAAGCAGAGGAACTCTACAGCAATTGATTGAGATTGGTCAAAGTCAACAACAGGAACTCATACAAAGGCAACAACAACTAAAACAAGCTCATGATCATTTGGTTGAAAATTCAAAAACAATATTGGCTGCCCAGGAAGTTTT...

CDS

Download CDS FASTA

426 bp · TkA02G075540|TK1151|CDS

GATATTGAGAATATAACAGAAACTTCATTAAACAGACAAAAACAACTTGTTGATAGTCAGAATGCTGCACTTGAAGTTCTTCAAACCGTAACAAGTTTTCAGTCACAAGCACTCGAAGAAAGCAGAGGAACTCTACAGCAATTGATTGAGATTGGTCAAAGTCAACAACAGGAACTCATACAAAGGCAACAACAACTAAAACAAGCTCATGATCATTTGGTTGAAAATTCAAAAACAATATTGGCTGCCCAGGAAGTTTT...

Protein

Download Protein FASTA

142 aa · TkA02G075540|TK1151|PROTEIN

DIENITETSLNRQKQLVDSQNAALEVLQTVTSFQSQALEESRGTLQQLIEIGQSQQQELIQRQQQLKQAHDHLVENSKTILAAQEVFESKQANMFLAIDKLFTLHNAILLESRVIKAFIVYSILIFTLYMFTSTKQTYNIRP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G075540`
TK1151 ID	TkA02G075540
OH-1004 ID	LXL04_022854
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 23.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G075540

Location Chr02:19558446-19559044 (+)

Description Similar to GEX1: Protein GAMETE EXPRESSED 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55490`	Has a dual function during gametophyte development and early embryogenesis.	Arabidopsis thaliana GEX1 has dual functions in gametophyte development and early embryogenesis.2011 · DOI: 10.1111/j.1365-313x.2011.04713.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022854 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007344 pronuclear fusion Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0061472 karyomere membrane fusion Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G55490

dre:559540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.318

Rank 1 · TkA02G075540 · TK1151

Cell membrane0.220

Rank 2 · TkA02G075540 · TK1151

Cytoplasm0.206

Rank 3 · TkA02G075540 · TK1151

Golgi apparatus0.156

Rank 4 · TkA02G075540 · TK1151

Lysosome / Vacuole0.119

Rank 5 · TkA02G075540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28019HmpF14-94 aa

PF17408MCD_N30-82 aa

PF30603DUF866534-56 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G075540	`PF28019`	HmpF	14	94	0.005	16.1
TkA02G075540	`PF17408`	MCD_N	30	82	0.1	13.5
TkA02G075540	`PF30603`	DUF8665	34	56	0.12	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q681K7`	Arabidopsis thaliana	sp\|Q681K7\|GEX1_ARATH Protein GAMETE EXPRESSED 1	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card