TkA02G070150 | RubberDandelionOmics

Gene overview

TkA02G070150

Reference: TK1151 Chr: Chr02 Coordinates: 18213049-18214799 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA02G070150|TK1151|cDNA

ATGGGTCCTTCAGAAACTCTAAGGAACAAGTGTGCAGCCTGCTATCGTCAATTCAACAGATTTGAGCACCTAGTGGAACACATGAGAACTTCATATCACTCGGTTCATGAACCCATGTGTGGAATTTGTGGAAAACGATGCCGATCGTTTGAATCTCTTCGTGAGCATCTTATAGGGCCATTGCCAAAGGCAGAATGTGAAAGGGTGTTCCGCGACCGTGGATGTGACATTTGCTTAACCATCCTTACCAGCCGTTATGC...

CDS

Download CDS FASTA

1053 bp · TkA02G070150|TK1151|CDS

ATGGGTCCTTCAGAAACTCTAAGGAACAAGTGTGCAGCCTGCTATCGTCAATTCAACAGATTTGAGCACCTAGTGGAACACATGAGAACTTCATATCACTCGGTTCATGAACCCATGTGTGGAATTTGTGGAAAACGATGCCGATCGTTTGAATCTCTTCGTGAGCATCTTATAGGGCCATTGCCAAAGGCAGAATGTGAAAGGGTGTTCCGCGACCGTGGATGTGACATTTGCTTAACCATCCTTACCAGCCGTTATGC...

Protein

Download Protein FASTA

350 aa · TkA02G070150|TK1151|PROTEIN

MGPSETLRNKCAACYRQFNRFEHLVEHMRTSYHSVHEPMCGICGKRCRSFESLREHLIGPLPKAECERVFRDRGCDICLTILTSRYALRAHRDACQLSCGNNGLLHRFANMGIQDDLRIDSGKSRAVALACKMVGGGSDGSLDLCAKICIIDEYENTIFRSYVKPQLPVTNYRYETTGIRPEYLRDAMPLRQVQRKIQDFLCNGEPIWKIHPRGGKARILVGHGLDHYLRCLEFDYPSLKIRDTATYPPLMKTSKLSNSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G070150`
TK1151 ID	TkA02G070150
OH-1004 ID	LXL04_006150
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.300
Protein coverage (%)	TK1151 98.571 / OH-1004 98.777 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G070150`
Location	Chr02:18213049-18214799 (+)
Description	Similar to REXO4: RNA exonuclease 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006150` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000027 ribosomal large subunit assembly Biological Process GO:0006281 DNA repair Biological Process GO:0006308 DNA catabolic process Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003690 double-stranded DNA binding Molecular Function
KEGG gene cross-reference	afm:AFUA_2G05560 hsa:57109 mmu:227656 sce:YOL080C xla:379197 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.477

Rank 1 · TkA02G070150 · TK1151

Cytoplasm0.423

Rank 2 · TkA02G070150 · TK1151

Cell membrane0.100

Rank 3 · TkA02G070150 · TK1151

Mitochondrion0.087

Rank 4 · TkA02G070150 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA02G070150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12756zf-C2H2_28-34 aa

PF00096zf-C2H210-33 aa

PF13894zf-C2H2_410-30 aa

PF13912zf-C2H2_610-34 aa

PF23320Zn_SUZ1210-31 aa

PF16278zf-C2HE10-30 aa

PF12874zf-met11-29 aa

PF12171zf-C2H2_jaz11-33 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G070150	`PF12756`	zf-C2H2_2	8	34	0.081	13.9
TkA02G070150	`PF00096`	zf-C2H2	10	33	4.9e-06	27.4
TkA02G070150	`PF13894`	zf-C2H2_4	10	30	3e-05	25.1
TkA02G070150	`PF13912`	zf-C2H2_6	10	34	0.0052	17.5
TkA02G070150	`PF23320`	Zn_SUZ12	10	31	0.01	16.2
TkA02G070150	`PF16278`	zf-C2HE	10	30	0.072	14.2
TkA02G070150	`PF12874`	zf-met	11	29	0.0051	17.8
TkA02G070150	`PF12171`	zf-C2H2_jaz	11	33	0.24	12.3
TkA02G070150	`PF23320`	Zn_SUZ12	37	57	0.01	16.2
TkA02G070150	`PF12756`	zf-C2H2_2	37	57	0.081	13.9
TkA02G070150	`PF13894`	zf-C2H2_4	39	57	3e-05	25.1
TkA02G070150	`PF12171`	zf-C2H2_jaz	39	57	0.24	12.3
TkA02G070150	`PF00096`	zf-C2H2	40	57	4.9e-06	27.4
TkA02G070150	`PF12874`	zf-met	40	59	0.0051	17.8
TkA02G070150	`PF13912`	zf-C2H2_6	40	57	0.0052	17.5
TkA02G070150	`PF16278`	zf-C2HE	40	57	0.072	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card