TkA02G067460 | RubberDandelionOmics

Gene overview

TkA02G067460

Reference: TK1151 Chr: Chr02 Coordinates: 17495689-17497301 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · TkA02G067460|TK1151|cDNA

ATGGGGAATGCAGTGAGACTTCAAATGGGTGTAGTGTTGATGTTTGGTGGTCAAATGCCTCTTATCAAGGTTGGAAGAACGGCTGGTCAATTTGCTAAGCATAGATCGATACCTTTTGAAGAAAAGAAGGGTGTGAAGCTACCAAGTTATAGAGGCGATAATGCAGAAGGTAAACCAAAGCTCCATAGTGGTGAAGACAAGGATGTTCAACCAACACTACTAATTACTTTCAACACAGACTATTCAGGGAAGCATGTAGG...

CDS

Download CDS FASTA

531 bp · TkA02G067460|TK1151|CDS

ATGGGGAATGCAGTGAGACTTCAAATGGGTGTAGTGTTGATGTTTGGTGGTCAAATGCCTCTTATCAAGGTTGGAAGAACGGCTGGTCAATTTGCTAAGCATAGATCGATACCTTTTGAAGAAAAGAAGGGTGTGAAGCTACCAAGTTATAGAGGCGATAATGCAGAAGGTAAACCAAAGCTCCATAGTGGTGAAGACAAGGATGTTCAACCAACACTACTAATTACTTTCAACACAGACTATTCAGGGAAGCATGTAGG...

Protein

Download Protein FASTA

176 aa · TkA02G067460|TK1151|PROTEIN

MGNAVRLQMGVVLMFGGQMPLIKVGRTAGQFAKHRSIPFEEKKGVKLPSYRGDNAEGKPKLHSGEDKDVQPTLLITFNTDYSGKHVGILSSVFVTNLNTGSNKVDYDKVEIYFHEIPEDDVDKLNDEGLLLRVAGALIIEHPLIVPYVKKLGQLIDSVMGLPKALTEKLLKEAMKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G067460`
TK1151 ID	TkA02G067460
OH-1004 ID	LXL04_002685
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 97.727 / OH-1004 67.339 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G067460

Location Chr02:17495689-17497301 (-)

Description Similar to DHAPS-1: Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33510`	Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002685 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0003849 3-deoxy-7-phosphoheptulonate synthase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

nta:107775732

sly:544153

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · TkA02G067460 · TK1151

Nucleus0.243

Rank 2 · TkA02G067460 · TK1151

Mitochondrion0.186

Rank 3 · TkA02G067460 · TK1151

Peroxisome0.105

Rank 4 · TkA02G067460 · TK1151

Extracellular0.094

Rank 5 · TkA02G067460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01474DAHP_synth_26-60 aa

PF02545Maf79-172 aa

PF25638DUF5983_N91-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G067460	`PF01474`	DAHP_synth_2	6	60	4.2e-17	62.5
TkA02G067460	`PF02545`	Maf	79	172	1.4e-11	45.2
TkA02G067460	`PF25638`	DUF5983_N	91	135	0.037	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00218`	Arabidopsis thaliana	sp\|Q00218\|AROG_ARATH Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic	83.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card