Gene Card
Gene overview
cDNA / CDS / Protein Sequences
768 bp · TkA02G064390|TK1151|cDNA
TATAGAAAAGTTTCTATAAAATTATTTGGGAACCACGTGGTTTTCATTTCTAGATTCGCTGGCATCAATCACTTTCAATTTCACAGGTATGGAACAACATGGAAGTACAGAGAAGGACGAGCTACATACATCGAACTACTTCACCTATGGGATATCACCTCTGGCGAGCTATCAAGATTCACCACCTATTTCTCATTCATGATAGATTCAAAATCGGATAAATATCATGGCGATGGGCTCGCATTCTTTCTTGCCGAGAG...
768 bp · TkA02G064390|TK1151|CDS
TATAGAAAAGTTTCTATAAAATTATTTGGGAACCACGTGGTTTTCATTTCTAGATTCGCTGGCATCAATCACTTTCAATTTCACAGGTATGGAACAACATGGAAGTACAGAGAAGGACGAGCTACATACATCGAACTACTTCACCTATGGGATATCACCTCTGGCGAGCTATCAAGATTCACCACCTATTTCTCATTCATGATAGATTCAAAATCGGATAAATATCATGGCGATGGGCTCGCATTCTTTCTTGCCGAGAG...
Protein
Download Protein FASTA255 aa · TkA02G064390|TK1151|PROTEIN
YRKVSIKLFGNHVVFISRFAGINHFQFHRYGTTWKYREGRATYIELLHLWDITSGELSRFTTYFSFMIDSKSDKYHGDGLAFFLAESNSAIKTSSSMGIPITNSRSTNSFIVVAFDTFANLEWDPKNSSNDLIYDYLSKNLSVAVFVIDMLREWVIFGFLAATRLAVQTHSVKYWAFNSSDLRINANNTLPPTSGPDPLNDKNITVLVVSLVVGLFILITFLTLIVFCMWRRKKSMKDEQGFDVWMNIELEMGTT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G064390 |
|---|---|
| TK1151 ID | TkA02G064390 |
| OH-1004 ID | LXL04_017227 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 62.400 |
| Protein coverage (%) | TK1151 87.451 / OH-1004 42.812Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G064390 |
|---|---|
| Location | Chr02:16701564-16702423 (+) |
| Description | Similar to LECRK91: L-type lectin-domain containing receptor kinase IX.1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002229 defense response to oomycetes Biological Process GO:0006468 protein phosphorylation Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process GO:0042742 defense response to bacterium Biological Process GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process GO:1900426 positive regulation of defense response to bacterium Biological Process GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component |
| KEGG gene cross-reference | ath:AT2G37710 ath:AT3G55550 ath:AT5G10530 ath:AT5G55830 ath:AT5G65600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13497DUF412118-86 aaPF00139Lectin_legB35-127 aaPF03388Lectin_leg-like49-120 aaPF18483Lectin_L-type_dom59-125 aaPF28870C3orf85_N95-134 aaPF31037DUF8777132-165 aaPF27947SPACA1132-229 aaPF00139Lectin_legB139-186 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G064390 | PF13497 | DUF4121 | 18 | 86 | 0.059 | 13.3 |
| TkA02G064390 | PF00139 | Lectin_legB | 35 | 127 | 1.9e-25 | 90.5 |
| TkA02G064390 | PF03388 | Lectin_leg-like | 49 | 120 | 0.0038 | 17.3 |
| TkA02G064390 | PF18483 | Lectin_L-type_dom | 59 | 125 | 0.023 | 15.3 |
| TkA02G064390 | PF28870 | C3orf85_N | 95 | 134 | 0.11 | 13.3 |
| TkA02G064390 | PF31037 | DUF8777 | 132 | 165 | 0.01 | 16.6 |
| TkA02G064390 | PF27947 | SPACA1 | 132 | 229 | 0.22 | 11.8 |
| TkA02G064390 | PF00139 | Lectin_legB | 139 | 186 | 1.9e-25 | 90.5 |
| TkA02G064390 | PF07047 | OPA3 | 149 | 165 | 0.1 | 13.2 |
| TkA02G064390 | PF05101 | VirB3 | 154 | 168 | 3.1 | 8.9 |
| TkA02G064390 | PF28870 | C3orf85_N | 164 | 180 | 0.11 | 13.3 |
| TkA02G064390 | PF15179 | Myc_target_1 | 167 | 193 | 0.5 | 11.0 |
| TkA02G064390 | PF22812 | CR_prot_dom_plant | 187 | 234 | 0.1 | 13.8 |
| TkA02G064390 | PF15179 | Myc_target_1 | 187 | 236 | 0.5 | 11.0 |
| TkA02G064390 | PF07047 | OPA3 | 194 | 238 | 0.1 | 13.2 |
| TkA02G064390 | PF08693 | SKG6 | 199 | 238 | 0.4 | 10.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.