TkA02G062450 | RubberDandelionOmics

Gene overview

TkA02G062450

Reference: TK1151 Chr: Chr02 Coordinates: 16301940-16304765 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1534 bp · TkA02G062450|TK1151|cDNA

ATATTGCCAACCCCTAGAGAGAGAAAGAAGACCATTAACTGGCTTCCAAATTATACCTATAAAACTTAAAGTTAATCTATCCATATCAAAGCGATTAGCCAAATAAGCTCTGTTCTTTATACACCAAAAAAAGGGTTCTTCTTCCCTCCGTTTTCTGGTTTGATCCATCTGCTGACAAGGTGTTTGATAAATTGCCGAAGAGAGTTTATTCCGGTTATGGAGATTTCACATTTCAGAAACTTATCAGGACTAACAGGAAT...

CDS

Download CDS FASTA

651 bp · TkA02G062450|TK1151|CDS

ATGGAGATTTCACATTTCAGAAACTTATCAGGACTAACAGGAATAGAAGATTCCTCTTTCAATTTTCAATGTCCACTCAATTCCTTCGATAATCAACTAGATTCAATGGCGTTTGGAGACAACGTCGATCACATTCAAGGTCATGCAGGTGTGTTTGACTTTGACTATTACAAACCTGTAATCGAACCATCTTCAAGGCCAAGTAAACAGATCAAAACAGACAGCTGGAATTCATCCACAACAACCGATCATTCGTATCT...

Protein

Download Protein FASTA

216 aa · TkA02G062450|TK1151|PROTEIN

MEISHFRNLSGLTGIEDSSFNFQCPLNSFDNQLDSMAFGDNVDHIQGHAGVFDFDYYKPVIEPSSRPSKQIKTDSWNSSTTTDHSYLNLPHQNTLVTPKEEMTVSSKSRNGFIYEKNLGFVNGVHGGLDVAKKDVKFSTPAQDHILAERKRREKLSQRFIALSALVPGLKKMDKASVLGDAIKHMKTLQEKVKTLEDQIKKRPNTESVFLLKDMKC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G062450`
TK1151 ID	TkA02G062450
OH-1004 ID	LXL04_017259
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 98.148 / OH-1004 66.044 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G062450

Location Chr02:16301940-16304765 (+)

Description Similar to BHLH25: Transcription factor bHLH25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37850`	Transcription factor bHLH25.	No verified direct reference in this release
`At2g22750`	Transcription factor bHLH18.	No verified direct reference in this release
`At2g22760`	Transcription factor bHLH19.	No verified direct reference in this release
`At2g22770`	Transcription activator that regulates the expression of at least NAI2, PYK10 and PBP1.	A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01636.x NAI1 gene encodes a basic-helix-loop-helix-type putative transcription factor that regulates the formation of an endoplasmic reticulum-derived structure, the ER body.2004 · DOI: 10.1105/tpc.021154 Activation of an ER-body-localized beta-glucosidase via a cytosolic binding partner in damaged tissues of Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci126 PYK10, a beta-glucosidase located in the endoplasmatic reticulum, is crucial for the beneficial interaction between Arabidopsis thaliana and the endophytic fungus Piriformospora indica.2008 · DOI: 10.1111/j.1365-313x.2008.03424.x Antagonistic jacalin-related lectins regulate the size of ER body-type beta-glucosidase complexes in Arabidopsis thaliana.2008 · DOI: 10.1093/pcp/pcn075 NAI2 is an endoplasmic reticulum body component that enables ER body formation in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.059345
`At2g46510`	Transcription activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017259 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G22750

ath:AT2G22760

ath:AT2G22770

ath:AT4G37850

ath:AT5G57150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · TkA02G062450 · TK1151

Cytoplasm0.088

Rank 2 · TkA02G062450 · TK1151

Cell membrane0.022

Rank 3 · TkA02G062450 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA02G062450 · TK1151

Plastid0.011

Rank 5 · TkA02G062450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH144-189 aa

PF23177bHLH_IRO3147-201 aa

PF23173bHLH_SAC51148-191 aa

PF23176bHLH_LHW152-195 aa

PF05769SIKE172-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G062450	`PF00010`	HLH	144	189	2.3e-10	40.8
TkA02G062450	`PF23177`	bHLH_IRO3	147	201	4.5e-09	37.3
TkA02G062450	`PF23173`	bHLH_SAC51	148	191	5.6e-05	23.7
TkA02G062450	`PF23176`	bHLH_LHW	152	195	0.066	13.9
TkA02G062450	`PF05769`	SIKE	172	208	0.1	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T072`	Arabidopsis thaliana	sp\|Q9T072\|BH025_ARATH Transcription factor bHLH25	42.900%	Swiss-Prot	Medium
`Q1PF17`	Arabidopsis thaliana	sp\|Q1PF17\|BH018_ARATH Transcription factor bHLH18	68.300%	Swiss-Prot	Low
`Q1PF16`	Arabidopsis thaliana	sp\|Q1PF16\|BH019_ARATH Transcription factor bHLH19	57.300%	Swiss-Prot	Low
`Q8S3F1`	Arabidopsis thaliana	sp\|Q8S3F1\|BH020_ARATH Transcription factor NAI1	59.700%	Swiss-Prot	Low
`Q9ZPY8`	Arabidopsis thaliana	sp\|Q9ZPY8\|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE	64.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card