TkA02G056500 | RubberDandelionOmics

Gene overview

TkA02G056500

Reference: TK1151 Chr: Chr02 Coordinates: 14725292-14729457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1471 bp · TkA02G056500|TK1151|cDNA

AAGACTAAAAAAAGTTAGGACTAAACTTAATATTTTGTGAAAGTTTAGCCTCATAACAGTCATAACTCTATGTTATTTTCATTTGGAATTGGAACCCTTAAACACAAACGATTTTCCACTTCGTGCAAACTTCCCCAACACCACGGTTACAGTCGCCATTAACTCCGGCCTGACTGCAAAACCCCTTCCAGTAAGCATCCAATGCAAGTTCTCAGTTGGAGCTGGAGCCCTCGTTTCGCCGTTGCTGTTAACAGGTCGTG...

CDS

Download CDS FASTA

843 bp · TkA02G056500|TK1151|CDS

ATGCAAGTTCTCAGTTGGAGCTGGAGCCCTCGTTTCGCCGTTGCTGTTAACAGGTCGTGCCGGAAAGTCTCGAGCTTCCGAGCATTTTCATCAGATTCATCCAGTCAATCGCGCGGCGGTCTCCCTCGATTCTTCTCCGACGTCCTCCCTCCCTCCAAGGGTTCCGCTGTTCGTATCCAAGGGGATGAATTCTGGCATATGACTAAAGTTCTCAGATTGAGTACTGATGACAGGATAGAGCTCTTTAATGGGAAAGGAGG...

Protein

Download Protein FASTA

280 aa · TkA02G056500|TK1151|PROTEIN

MQVLSWSWSPRFAVAVNRSCRKVSSFRAFSSDSSSQSRGGLPRFFSDVLPPSKGSAVRIQGDEFWHMTKVLRLSTDDRIELFNGKGGLVKGCIERLDRNGADIVALENPILVSTNTTQWHVFAAFGTLKGGRSDWLIEKCTELGASSVTPLLTERSPSISDNRVDRLQRVILAAAKQCQRLHEMTLNPPLKVCDILPIVSRSKLSFIATAEATPVLNVLTSSKQDSIGSIIVGPEGDFTDAEVKLILEAGARAVGLGPHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G056500`
TK1151 ID	TkA02G056500
OH-1004 ID	LXL04_017308
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.643 / OH-1004 99.643 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G056500`
Location	Chr02:14725292-14729457 (-)
Description	Similar to rsmE: Ribosomal RNA small subunit methyltransferase E (Synechocystis sp. (strain PCC 6803 / Kazusa)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017308` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0070475 rRNA base methylation Biological Process GO:0005737 cytoplasm Cellular Component GO:0016301 kinase activity Molecular Function GO:0070042 rRNA (uridine-N3-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	aae:aq_165 bas:BUsg_395 bsu:BSU25440 mtu:Rv2372c mtv:RVBD_2372c syn:slr0722 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.956

Rank 1 · TkA02G056500 · TK1151

Mitochondrion0.058

Rank 2 · TkA02G056500 · TK1151

Nucleus0.033

Rank 3 · TkA02G056500 · TK1151

Cytoplasm0.024

Rank 4 · TkA02G056500 · TK1151

Peroxisome0.012

Rank 5 · TkA02G056500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18335SH3_1351-92 aa

PF20260PUA_459-104 aa

PF03976PPK284-110 aa

PF04452Methyltrans_RNA86-111 aa

PF21062Reovirus_L2_4th100-180 aa

PF04452Methyltrans_RNA120-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G056500	`PF18335`	SH3_13	51	92	0.084	13.4
TkA02G056500	`PF20260`	PUA_4	59	104	8.6e-13	48.9
TkA02G056500	`PF03976`	PPK2	84	110	0.075	13.3
TkA02G056500	`PF04452`	Methyltrans_RNA	86	111	2e-38	132.3
TkA02G056500	`PF21062`	Reovirus_L2_4th	100	180	0.11	13.0
TkA02G056500	`PF04452`	Methyltrans_RNA	120	274	2e-38	132.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card