TkA02G047310 | RubberDandelionOmics

Gene overview

TkA02G047310

Reference: TK1151 Chr: Chr02 Coordinates: 12227257-12231094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3011 bp · TkA02G047310|TK1151|cDNA

CTTGTCTTCTTCTTTCAGCATTTACTCATGGGTCATCCCCTTTCCCGGGTCGGGTCAACAATGCTCACAAATTTATGTACTCACAGAGAAGACCCAGAGAGAGAAAAACAGGGAGTAATAAGTTGCGCAATTGAAGAAAAAAACAGGTATTTTATTAGGCGTGGGTGAAAATGGCGGATAGTGATGAAGAATGGGTTCTGGTAAAACCAGTTTTAGATAAAGATTTGTGGAATCCATCATCGTCGTCGTCATCGAGCAGC...

CDS

Download CDS FASTA

2178 bp · TkA02G047310|TK1151|CDS

ATGGCGGATAGTGATGAAGAATGGGTTCTGGTAAAACCAGTTTTAGATAAAGATTTGTGGAATCCATCATCGTCGTCGTCATCGAGCAGCTCGAATGAAACAGAGAACAAAGCTTTGAAGGTGAGGTTCAATGGCGAAGCTAAGCACTGGACTGATGCTCTTCCCGTCGGCAATGGCCGCCTTGGTGCTATGATCTGGGGCGGCGTCGCCTCTGAAACCATCAATCTTAATGATGACACCTTATGGACTGGGATTCCGGG...

Protein

Download Protein FASTA

725 aa · TkA02G047310|TK1151|PROTEIN

MADSDEEWVLVKPVLDKDLWNPSSSSSSSSSNETENKALKVRFNGEAKHWTDALPVGNGRLGAMIWGGVASETINLNDDTLWTGIPGEYTNQEAPAVLSEVRKLVDDGKYPEATTAAVKLSGDPSDVYQLLGDINLEFDGDLSPYDDKTYQRELDLDTATVKIKYSIGEVEFTREHFASYPDQVFVSKISGSKSGSLSFTAFLDSKLHHHSYVNDQNQIIMEGSCPGKRIPPTVFATTDDNPEGIKFSAILNLQINGDSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G047310`
TK1151 ID	TkA02G047310
OH-1004 ID	LXL04_017363
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 99.724 / OH-1004 70.772 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G047310

Location Chr02:12227257-12231094 (+)

Description Similar to FUC95A: Alpha-L-fucosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34260`	Hydrolyzes alpha-1,2-linked fucose.	Identification of an Arabidopsis gene encoding a GH95 alpha1,2-fucosidase active on xyloglucan oligo- and polysaccharides.2008 · DOI: 10.1016/j.phytochem.2008.03.024 AXY8 encodes an α-fucosidase, underscoring the importance of apoplastic metabolism on the fine structure of Arabidopsis cell wall polysaccharides.2011 · DOI: 10.1105/tpc.111.089193

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004560 alpha-L-fucosidase activity Molecular Function

GO:0047513 1,2-alpha-L-fucosidase activity Molecular Function

KEGG gene cross-reference

ani:ANIA_08149

ath:AT4G34260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.793

Rank 1 · TkA02G047310 · TK1151

Nucleus0.290

Rank 2 · TkA02G047310 · TK1151

Mitochondrion0.064

Rank 3 · TkA02G047310 · TK1151

Lysosome / Vacuole0.058

Rank 4 · TkA02G047310 · TK1151

Cell membrane0.054

Rank 5 · TkA02G047310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14498Glyco_hyd_65N_243-290 aa

PF10516SHNi-TPR125-137 aa

PF22124Glyco_hydro_95_cat317-723 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G047310	`PF14498`	Glyco_hyd_65N_2	43	290	3.9e-62	211.0
TkA02G047310	`PF10516`	SHNi-TPR	125	137	0.29	11.4
TkA02G047310	`PF22124`	Glyco_hydro_95_cat	317	723	8e-172	572.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7W8`	Arabidopsis thaliana	sp\|Q8L7W8\|FUCO2_ARATH Alpha-L-fucosidase 2	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card